KEGG   Saccharomyces cerevisiae (budding yeast): YJL194W
Entry
YJL194W           CDS       T00005                                 

Gene name
CDC6
Definition
(RefSeq) AAA family ATPase CDC6
  KO
K02213  cell division control protein 6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YJL194W (CDC6)
   04113 Meiosis - yeast
    YJL194W (CDC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YJL194W (CDC6)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YJL194W (CDC6)
SSDB
Motif
Pfam: AAA_22 AAA AAA_16 Cdc6_C TniB AAA_19 KAP_NTPase ATPase_2 AAA_11 DUF2075 AFG1_ATPase
Other DBs
NCBI-GeneID: 853244
NCBI-ProteinID: NP_012341
SGD: S000003730
UniProt: P09119
LinkDB
Structure
PDB: 
5V8F

Position
X:69338..70879
AA seq 513 aa
MSAIPITPTKRIRRNLFDDAPATPPRPLKRKKLQFTDVTPESSPEKLQFGSQSIFLRTKA
LLQKSSELVNLNSSDGALPARTAEYEQVMNFLAKAISEHRSDSLYITGPPGTGKTAQLDM
IIRQKFQSLPLSLSTPRSKDVLRHTNPNLQNLSWFELPDGRLESVAVTSINCISLGEPSS
IFQKIFDSFQDLNGPTLQIKNMQHLQKFLEPYHKKTTFVVVLDEMDRLLHANTSETQSVR
TILELFLLAKLPTVSFVLIGMANSLDMKDRFLSRLNLDRGLLPQTIVFQPYTAEQMYEIV
IQKMSSLPTIIFQPMAIKFAAKKCAGNTGDLRKLFDVLRGSIEIYELEKRFLLSPTRGSL
NSAQVPLTPTTSPVKKSYPEPQGKIGLNYIAKVFSKFVNNNSTRTRIAKLNIQQKLILCT
IIQSLKLNSDATIDESFDHYIKAITKTDTLAPLQRNEFLEICTILETCGLVSIKKTKCKG
KTKRFVDKIDVDLDMREFYDEMTKISILKPFLH
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtcagctataccaataactccaactaagcgtatcagaagaaatctatttgacgatgct
ccagcaacgcctccacgacctttgaaaagaaaaaagttgcagttcacagatgttacacca
gaatcatccccagaaaaactgcagtttggctcacagtctatttttttgaggacaaaggca
cttttgcagaagtcatctgagctagtcaacttgaatagcagcgatggtgcattgccagca
agaacagcagagtacgaacaagttatgaattttttggcgaaggcaatttctgaacacagg
tccgattcactgtacatcacgggtccgcctggcactggcaagactgcccagcttgatatg
attataagacagaagttccagtccctcccattgtcgctctccacgccacgctcgaaggac
gtgctgagacatacgaatccgaacttgcagaatttgtcctggtttgaattgcccgatgga
aggctagaatccgtggcggtaaccagtattaattgtatatcgttgggagagccgtcctcc
attttccagaagattttcgattccttccaagatctgaatggcccaacattgcaaataaaa
aacatgcagcatctacagaagttcttagagccttatcataagaaaactacgtttgtggtt
gtgttggacgagatggacaggctattgcatgctaacacgagcgagacacaatcagttaga
actattcttgaattattccttttggcgaaattgcctactgtgagttttgtgttaatcggt
atggctaatagtctagatatgaaagataggtttctttccaggttaaatttggacagaggg
ttgttaccgcaaactatagtttttcagccatacactgctgagcaaatgtatgaaatcgtc
attcaaaaaatgagtagtctgcccactattatcttccaaccgatggccatcaaattcgca
gcaaagaagtgtgctggaaatacgggtgaccttcgaaaactttttgatgtcttaagggga
agtatcgaaatctatgagttagaaaagcggtttctgctttcaccaacaagaggatcattg
aactctgcgcaagttcctttgacgccaactacttctccggtaaagaaatcgtatccagaa
ccacaaggtaaaataggcttgaactacatagccaaggtcttctcaaaattcgtgaacaat
aattctacgagaacgaggatagccaaactaaacatccagcaaaaattaattctttgcacc
ataattcaatcactgaagctaaattccgatgctacaatcgacgaatcgtttgatcattat
atcaaagcgataacaaaaactgatactttagcaccattgcagagaaatgaatttttggaa
atctgtacaattttagaaacttgtgggctggtttcaatcaaaaagacaaagtgtaaaggg
aaaaccaagagatttgttgataagattgatgttgatctcgacatgcgagaattttatgat
gagatgaccaaaatttcaattttgaaacctttccttcactag

DBGET integrated database retrieval system