KEGG   Saccharomyces cerevisiae (budding yeast): YJR046W
Entry
YJR046W           CDS       T00005                                 

Gene name
TAH11, CDT1, SID2
Definition
(RefSeq) Tah11p
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YJR046W (TAH11)
   04113 Meiosis - yeast
    YJR046W (TAH11)
SSDB
Motif
Pfam: CDT1_C CDT1
Other DBs
NCBI-GeneID: 853504
NCBI-ProteinID: NP_012580
SGD: S000003807
UniProt: P47112
LinkDB
Structure
PDB: 

Position
X:522048..523862
AA seq 604 aa
MSGTANSRRKEVLRVPVIDLNRVSDEEQLLPVVRAILLQHDTFLLKNYANKAVLDALLAG
LTTKDLPDTSQGFDANFTGTLPLEDDVWLEQYIFDTDPQLRFDRKCRNESLCSIYSRLFK
LGLFFAQLCVKSVVSSAELQDCISTSHYATKLTRYFNDNGSTHDGADAGATVLPTGDDFQ
YLFERDYVTFLPTGVLTIFPCAKAIRYKPSTMATTDNSWVSIDEPDCLLFHTGTLLARWS
QGMHTTSPLQIDPRANIVSLTIWPPLTTPISSKGEGTIANHLLEQQIKAFPKVAQQYYPR
ELSILRLQDAMKFVKELFTVCETVLSLNALSRSTGVPPELHVLLPQISSMMKRKIVQDDI
LKLLTIWSDAYVVELNSRGELTMNLPKRDNLTTLTNKSRTLAFVERAESWYQQVIASKDE
IMTDVPAFKINKRRSSSNSKTVLSSKVQTKSSNANALNNSRYLANSKENFMYKEKMPDSQ
ANLMDRLRERERRSAALLSQRQKRYQQFLAMKMTQVFDILFSLTRGQPYTETYLSSLIVD
SLQDSNNPIGTKEASEILAGLQGILPMDISVHQVDGGLKVYRWNSLDKNRFSKLLQIHKS
KQQD
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgagtggcacagctaatagtaggaggaaggaggttttgcgcgtgcctgtgatagatttg
aatagagtttcagatgaagagcagctgttgccggtggtgagggcaattttgctacagcat
gacacctttctgttaaaaaattatgctaacaaggctgttctagatgcactactagcgggg
ctcacgacaaaggacctgcctgacacgagtcaaggttttgatgcgaactttacgggtaca
ttaccgctagaagatgatgtttggctggagcagtacatatttgacactgatcctcaatta
cgcttcgatcggaagtgcaggaatgagtcactgtgctccatatatagtaggctgttcaaa
ctgggtctgtttttcgcccaactgtgtgtgaaaagtgtggtttctagcgcagaattgcaa
gactgtatcagcacctctcattatgcgactaagctgacccgttatttcaatgataatggt
agtacacacgatggtgcagatgcaggtgctaccgtgctgcccactggcgacgatttccag
tacctgtttgaaagggactatgttacttttcttccgacgggcgtgttgaccatcttcccc
tgtgccaaggctataaggtacaagccatcgactatggcgacgacggacaattcttgggtg
agtattgatgaacccgattgtcttctgttccacacggggaccctccttgcgcgctggtct
caaggtatgcacactacctcaccactccagatagatcctcgtgcgaacattgtttcgttg
accatctggcctccacttactacgccaatctcgagtaaaggagagggtacgattgccaat
catttgttggagcaacaaattaaggctttcccaaaagtcgctcagcaatactacccacgg
gagcttagtattctaagactccaagacgcaatgaagtttgttaaggagttgtttactgtt
tgcgagactgtattgtctttaaacgctctttccagatccacgggcgtcccaccagagctg
cacgttttgttaccccagatatccagcatgatgaaaaggaaaatagtgcaggatgatatt
ttgaagttattgaccatttggtctgatgcatacgtagtggaactgaactctagaggggag
ctgaccatgaatctacccaaaagagacaatctaacaacgttgaccaataagtctaggact
ttggcattcgtggaaagggcagagtcgtggtaccaacaagtgatagcttccaaggatgag
attatgactgatgtacccgctttcaaaataaataaaagaaggtccagctctaattctaaa
acagtcttgagcagtaaagtgcaaacgaagagctctaatgctaatgccttgaataactca
agatatttggcgaatagtaaggaaaatttcatgtacaaagagaagatgcctgattcgcaa
gcaaaccttatggacagactgcgtgaaagagagagacgttcggccgcattgctttctcaa
aggcaaaaacgttaccagcagtttctagcgatgaaaatgactcaggtatttgatattctt
ttttcgctgaccaggggccagccttatacagagacatatctaagctcgctaatcgtagat
agtttacaagatagtaataatcctatcggtacaaaagaagcaagtgaaattttagctggg
ctacaaggtatcctaccaatggacatatctgttcatcaagtggatggtgggttaaaagtt
tatagatggaacagtttggataaaaacagattttctaagctgttgcaaatccacaaatca
aaacaacaagattga

DBGET integrated database retrieval system