KEGG   Saccharomyces cerevisiae (budding yeast): YJR066W
Entry
YJR066W           CDS       T00005                                 

Gene name
TOR1, DRR1
Definition
(RefSeq) phosphatidylinositol kinase-related protein kinase TOR1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
sce04136  Autophagy - other
sce04138  Autophagy - yeast
sce04139  Mitophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YJR066W (TOR1)
   04136 Autophagy - other
    YJR066W (TOR1)
   04139 Mitophagy - yeast
    YJR066W (TOR1)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YJR066W (TOR1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YJR066W (TOR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YJR066W (TOR1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YJR066W (TOR1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YJR066W (TOR1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   YJR066W (TOR1)
Membrane trafficking [BR:sce04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    YJR066W (TOR1)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 HEAT_EZ HEAT Vac14_Fab1_bd DUF3437
Other DBs
NCBI-GeneID: 853529
NCBI-ProteinID: NP_012600
SGD: S000003827
UniProt: P35169
LinkDB
Structure
PDB: 
2KIT 2KIO 1W1N

Position
X:559416..566828
AA seq 2470 aa
MEPHEEQIWKSKLLKAANNDMDMDRNVPLAPNLNVNMNMKMNASRNGDEFGLTSSRFDGV
VIGSNGDVNFKPILEKIFRELTSDYKEERKLASISLFDLLVSLEHELSIEEFQAVSNDIN
NKILELVHTKKTSTRVGAVLSIDTLISFYAYTERLPNETSRLAGYLRGLIPSNDVEVMRL
AAKTLGKLAVPGGTYTSDFVEFEIKSCLEWLTASTEKNSFSSSKPDHAKHAALLIITALA
ENCPYLLYQYLNSILDNIWRALRDPHLVIRIDASITLAKCLSTLRNRDPQLTSQWVQRLA
TSCEYGFQVNTLECIHASLLVYKEILFLKDPFLNQVFDQMCLNCIAYENHKAKMIREKIY
QIVPLLASFNPQLFAGKYLHQIMDNYLEILTNAPANKIPHLKDDKPQILISIGDIAYEVG
PDIAPYVKQILDYIEHDLQTKFKFRKKFENEIFYCIGRLAVPLGPVLGKLLNRNILDLMF
KCPLSDYMQETFQILTERIPSLGPKINDELLNLVCSTLSGTPFIQPGSPMEIPSFSRERA
REWRNKNILQKTGESNDDNNDIKIIIQAFRMLKNIKSRFSLVEFVRIVALSYIEHTDPRV
RKLAALTSCEIYVKDNICKQTSLHSLNTVSEVLSKLLAITIADPLQDIRLEVLKNLNPCF
DPQLAQPDNLRLLFTALHDESFNIQSVAMELVGRLSSVNPAYVIPSIRKILLELLTKLKF
STSSREKEETASLLCTLIRSSKDVAKPYIEPLLNVLLPKFQDTSSTVASTALRTIGELSV
VGGEDMKIYLKDLFPLIIKTFQDQSNSFKREAALKALGQLAASSGYVIDPLLDYPELLGI
LVNILKTENSQNIRRQTVTLIGILGAIDPYRQKEREVTSTTDISTEQNAPPIDIALLMQG
MSPSNDEYYTTVVIHCLLKILKDPSLSSYHTAVIQAIMHIFQTLGLKCVSFLDQIIPTIL
DVMRTCSQSLLEFYFQQLCSLIIIVRQHIRPHVDSIFQAIKDFSSVAKLQITLVSVIEAI
SKALEGEFKRLVPLTLTLFLVILENDKSSDKVLSRRVLRLLESFGPNLEGYSHLITPKIV
QMAEFTSGNLQRSAIITIGKLAKDVDLFEMSSRIVHSLLRVLSSTTSDELSKVIMNTLSL
LLIQMGTSFAIFIPVINEVLMKKHIQHTIYDDLTNRILNNDVLPTKILEANTTDYKPAEQ
MEAADAGVAKLPINQSVLKSAWNSSQQRTKEDWQEWSKRLSIQLLKESPSHALRACSNLA
SMYYPLAKELFNTAFACVWTELYSQYQEDLIGSLCIALSSPLNPPEIHQTLLNLVEFMEH
DDKALPIPTQSLGEYAERCHAYAKALHYKEIKFIKEPENSTIESLISINNQLNQTDAAIG
ILKHAQQHHSLQLKETWFEKLERWEDALHAYNEREKAGDTSVSVTLGKMRSLHALGEWEQ
LSQLAARKWKVSKLQTKKLIAPLAAGAAWGLGEWDMLEQYISVMKPKSPDKEFFDAILYL
HKNDYDNASKHILNARDLLVTEISALINESYNRAYSVIVRTQIITEFEEIIKYKQLPPNS
EKKLHYQNLWTKRLLGCQKNVDLWQRVLRVRSLVIKPKQDLQIWIKFANLCRKSGRMRLA
NKALNMLLEGGNDPSLPNTFKAPPPVVYAQLKYIWATGAYKEALNHLIGFTSRLAHDLGL
DPNNMIAQSVKLSSASTAPYVEEYTKLLARCFLKQGEWRIATQPNWRNTNPDAILGSYLL
ATHFDKNWYKAWHNWALANFEVISMVQEETKLNGGKNDDDDDTAVNNDNVRIDGSILGSG
SLTINGNRYPLELIQRHVVPAIKGFFHSISLLETSCLQDTLRLLTLLFNFGGIKEVSQAM
YEGFNLMKIENWLEVLPQLISRIHQPDPTVSNSLLSLLSDLGKAHPQALVYPLTVAIKSE
SVSRQKAALSIIEKIRIHSPVLVNQAELVSHELIRVAVLWHELWYEGLEDASRQFFVEHN
IEKMFSTLEPLHKHLGNEPQTLSEVSFQKSFGRDLNDAYEWLNNYKKSKDINNLNQAWDI
YYNVFRKITRQIPQLQTLDLQHVSPQLLATHDLELAVPGTYFPGKPTIRIAKFEPLFSVI
SSKQRPRKFSIKGSDGKDYKYVLKGHEDIRQDSLVMQLFGLVNTLLKNDSECFKRHLDIQ
QYPAIPLSPKSGLLGWVPNSDTFHVLIREHRDAKKIPLNIEHWVMLQMAPDYENLTLLQK
IEVFTYALDNTKGQDLYKILWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSN
LMLDRITGKVIHIDFGDCFEAAILREKYPEKVPFRLTRMLTYAMEVSGIEGSFRITCENV
MRVLRDNKESLMAILEAFALDPLIHWGFDLPPQKLTEQTGIPLPLINPSELLRKGAITVE
EAANMEAEQQNETKNARAMLVLRRITDKLTGNDIKRFNELDVPEQVDKLIQQATSIERLC
QHYIGWCPFW
NT seq 7413 nt   +upstreamnt  +downstreamnt
atggaaccgcatgaggagcagatttggaagagtaaacttttgaaagcggctaacaacgat
atggacatggatagaaatgtgccgttggcaccgaatctgaatgtgaatatgaacatgaaa
atgaatgcgagcaggaacggggatgaattcggtctgacttctagtaggtttgatggagtg
gtgattggcagtaatggggatgtaaattttaagcccattttggagaaaattttccgcgaa
ttaaccagtgattacaaggaggaacgaaaattggccagtatttcattatttgatctacta
gtatccttggaacatgaattgtcgatagaagagttccaagcagtttcaaatgacataaac
aataagattttggagctggtccatacaaaaaaaacgagcactagggtaggggctgttcta
tccatagacactttgatttcattctacgcatatactgaaaggttgcctaacgaaacttca
cgactggctggttaccttcgagggctaataccttctaatgatgtagaggtcatgagactc
gctgcaaagactctgggcaagttagccgttccaggaggtacatatacctctgatttcgtg
gaatttgagataaagtcttgcttagaatggcttactgcctccacggaaaagaattcattc
tcgagttcgaagccagaccatgctaaacatgctgcgcttctgattataacagcgttggca
gagaattgtccttatttactctaccaatacttgaattccatactagataacatttggaga
gcactaagagacccacatttggtgatcagaattgatgcgtccattacattggccaaatgt
ctttccaccctacgaaatagggatcctcagttaactagccagtgggtgcagagattggct
acaagttgtgaatacggatttcaagtaaacacattagaatgcatccatgcaagtttgttg
gtttataaggaaatcttgtttttgaaggatccctttttgaatcaagtgttcgaccaaatg
tgtctaaattgcatagcttatgaaaatcataaagcgaaaatgattagagaaaagatttac
cagattgttcccctattagcatcgttcaatcctcaattatttgctggcaaatatttgcac
caaattatggacaactatttagagattttaaccaatgctccagcaaataaaataccacat
ctcaaagatgacaaaccacagattttaatatcgattggtgatattgcatatgaagtcggg
cccgatatcgcaccttatgtgaaacaaattcttgattatattgaacatgatttacagacg
aaattcaaattcagaaagaaatttgaaaatgaaattttctactgcatcggaagattggca
gttcccttgggccccgttctaggtaaattattaaacagaaatatactggacctgatgttc
aaatgccctctttccgactatatgcaggaaacgtttcaaattctgactgagagaatacca
tcactaggccccaaaataaatgacgagttgcttaacctagtctgttcaaccttatctgga
acaccatttatccagccagggtcaccaatggagataccatcgttttcgagagaaagagca
agagaatggagaaataaaaacatcctacagaaaactggtgaaagtaacgatgataataat
gatataaaaatcattatacaagcttttagaatgttaaaaaatatcaaaagcagattttcg
ttggtggaattcgtgagaattgttgcactttcttacattgagcatacagatcccagagta
aggaaactagctgcgttgacatcttgtgaaatttacgtcaaggataacatctgcaaacaa
acatcactacactctctgaacactgtatctgaagtgttatcaaagcttctagccattacg
attgcggaccctttacaagatatccgtttagaagttttaaagaatcttaatccatgtttc
gatccccagttggcacaaccagataatttgagactcttgtttactgcactgcacgatgag
tcgttcaatattcagtcagtagcaatggagcttgtcggtaggttgtcttccgtaaaccct
gcatacgtcatcccatcgataagaaaaatactactggaactgctaacaaaattaaaattc
tcaacttcttctcgagaaaaggaagaaactgccagtttgttatgtactcttatcaggtcg
agtaaagatgttgcgaaaccttatatcgaacctcttttaaatgttcttttaccaaaattc
caagatacctcttcaacggttgcatcaactgcactgagaactataggtgagctatctgtt
gtagggggcgaagatatgaagatatatcttaaggatttgtttcctttaattatcaaaaca
tttcaggatcaatcaaactctttcaagagagaagctgcacttaaggcccttggtcaactt
gcagcctcatctggttacgtgatagatcctttactcgactatcccgaattattgggtata
ttggtgaatatattgaagacagaaaactctcaaaatattaggagacaaacagtcactttg
ataggtatactgggagctatcgacccatatcgccaaaaagaacgtgaggttacctctact
accgatatatctacagaacagaacgccccgcctatcgacattgctcttctcatgcagggc
atgtctccttcgaatgatgagtattataccactgttgtcattcactgcctgctaaaaatc
ctaaaagatccatccctatcatcttaccacactgccgtgatccaagcgattatgcatatt
tttcaaacccttggtctaaaatgtgtttcattcttggaccagatcatcccaactattttg
gacgtaatgcgtacatgctctcagtcactattagaattttacttccaacagctttgctct
ttgattattatcgtaaggcaacacataagacctcatgtcgattctatattccaggctatc
aaagatttttcttcggttgctaagctacaaataacgcttgtaagtgttattgaagcaata
tcaaaggctctggagggtgaattcaaaagattggtccctcttactctgaccttgttcctt
gtaattttggagaatgacaagtctagtgacaaggtcctctccagaagggtattgagactg
ttagaatcgtttggtcctaacttagaaggttattcgcatttgattacacccaagatagtt
caaatggcagaattcaccagcgggaacctacaaaggtctgcaataattactattggcaaa
ctggccaaggatgttgacctttttgagatgtcctcaagaattgttcactctttacttagg
gtactaagttcaacaacgagtgacgaactctcaaaagtcattatgaatactttaagtcta
ctgctaatacaaatgggcacatcctttgctatcttcatccctgtcattaatgaagtttta
atgaagaaacatattcaacacacaatatatgatgacttgacaaacagaatattaaacaat
gatgttttacccacaaaaattcttgaagcaaatacaacggattataagcccgcggaacaa
atggaggcagcagatgctggggtcgcaaaattacctataaaccaatcagttttgaaaagt
gcatggaattctagccaacaaagaactaaagaagattggcaggaatggagcaaacgtcta
tccattcaattattaaaagagtcaccctcccatgctctaagagcttgttcaaatcttgca
agcatgtattatccactagccaaagaactttttaataccgcattcgcatgtgtttggacc
gaactttatagccaatatcaagaagatttaattgggtcattatgtatagccttatcttct
cccttaaatccaccagaaatacatcaaacattgttaaacctggtagaatttatggaacac
gatgacaaggcattaccaataccaactcaaagcctgggcgagtatgctgaaagatgtcac
gcctatgccaaagcgctacattataaagagattaaatttattaaagagcctgagaactca
actattgaatcattgatcagcattaacaaccagctgaatcaaacggatgctgcaattggt
atattaaagcatgcccaacaacatcattcacttcaattaaaggagacatggtttgaaaaa
ttagagcgttgggaagatgcactacatgcttataatgaacgtgaaaaggcaggtgatact
tccgtgagcgttacactcggtaagatgagatcccttcatgcccttggcgaatgggaacag
ttgtcgcaattggcagctagaaagtggaaagtttcgaagctacaaactaagaagctaata
gctcccttggcagctggtgctgcgtgggggttgggagagtgggatatgcttgagcaatat
atcagcgttatgaaacctaaatctccagataaggaattttttgatgcaattttatacttg
cacaagaatgattacgacaatgctagtaagcatatattaaacgccagagatttgcttgtg
actgaaatttccgcgttgatcaatgaaagttataatagagcatatagcgttattgttaga
actcaaataataacagagtttgaggaaatcatcaagtataaacaattgccacctaattcc
gagaaaaaacttcactatcaaaatctttggacaaaaagactgctgggctgccaaaaaaat
gtcgatttatggcaaagagtgcttagagtaagatcattggtaataaagcccaagcaagac
ctgcaaatatggataaaatttgcaaatttgtgcagaaaatctggtagaatgaggctagca
aataaggcattgaatatgctactagaaggaggcaacgatcctagtttaccaaatacgttc
aaagctcctcccccagttgtttacgcgcaactaaaatatatttgggctacaggagcttat
aaagaagcattaaaccacttgataggatttacatccaggttagcgcatgatcttggtttg
gatccgaataatatgatcgcgcaaagtgtcaaactctcaagtgcaagtactgctccgtat
gttgaggaatacacaaaattattagctcgatgttttttaaagcaaggtgagtggagaata
gcaacacaaccgaactggagaaacacaaatccggatgcaattcttggttcttatctattg
gctacacatttcgataaaaattggtacaaggcatggcataattgggccttagctaatttt
gaagtaatatccatggttcaggaagagactaagctcaacggaggtaagaatgatgatgat
gatgacacggcagttaataatgataatgtgcggattgacggtagtatcctaggaagtggt
tctttgactattaatggcaacagatacccgctagagcttattcaaagacatgttgttcca
gcgatcaagggcttttttcattcaatatctctattagaaacaagttgtttgcaagacacg
ttgaggttattgactcttttatttaactttggtggtattaaagaagtctcacaagccatg
tatgaaggcttcaatttgatgaaaatagagaactggcttgaagtcttaccacagttgatc
tctcgtatacatcagccagatcctacggtgagtaattcccttttgtcgttgctttctgat
ttagggaaagctcatccacaagctctcgtgtatcctttaactgtcgcgatcaagtctgaa
tctgtttcaagacaaaaagcggctctttcaataatagagaaaattaggattcatagtcca
gtcctggtaaaccaggcagaattagttagtcacgagttgatcagagtagccgttctatgg
cacgaattatggtatgaaggactggaagatgcgagccgccaatttttcgttgaacataac
atagaaaaaatgttttctactttagaacctttacataaacacttaggcaatgagcctcaa
acgttaagtgaggtatcgtttcagaaatcatttggtagagatttgaacgatgcctacgaa
tggttgaataactacaaaaagtcaaaagacatcaataatttgaaccaagcttgggatatt
tattataacgtcttcagaaaaataacacgtcaaataccacagttacaaaccttagactta
cagcatgtttctccccagcttctggctactcatgatctcgaattggctgttcctgggaca
tatttcccaggaaaacctaccattagaatagcgaagtttgagccattattttctgtgatc
tcttcgaagcaaaggccaagaaaattctccatcaagggtagcgacggtaaagattataaa
tacgttttaaagggacatgaagatataagacaagatagccttgttatgcaattatttggt
ctagttaacactttgttgaagaatgattcagagtgtttcaagagacatttggatatccaa
caatacccggctattccattgtcgcctaaatctggtttactaggatgggtaccaaatagt
gacacattccacgttttgatcagagaacaccgtgatgccaaaaaaattccgttgaacatt
gaacattgggttatgttacaaatggcccccgattatgagaatttgactcttttacaaaaa
attgaagtattcacgtacgctttagataatacaaaaggccaagacctttataaaatatta
tggttaaagagtaggtcgtcagagacatggctagaacgtagaacaacttatacgagatct
ttagcagttatgtccatgactggttatattctgggactaggtgatcgccatccaagcaac
ctgatgctagatagaatcaccggtaaagttatccacattgatttcggcgattgttttgaa
gctgccatcttaagagaaaagtatccagaaaaagtgccatttagactaactaggatgtta
acatacgcaatggaagttagtggaattgaaggcagtttccgaattacttgtgaaaatgtc
atgagagtcttaagagataataaagaatcattaatggcgatcttggaagcttttgcgctt
gatcctttgatccattggggatttgatttaccgccacaaaaacttactgagcaaactgga
attcctttgccgttgattaatcctagtgaattattaaggaagggggcaattactgtcgaa
gaagcggcaaatatggaagcagaacaacaaaatgagaccaaaaacgccagagcaatgctt
gttttgagacgtattacagataaattaacgggcaatgatatcaagaggttcaatgaatta
gacgtccctgagcaggttgataaactgatccaacaagccacttctattgaaaggttatgt
caacattatattggatggtgcccattctggtga

KEGG   Saccharomyces cerevisiae (budding yeast): YKL203C
Entry
YKL203C           CDS       T00005                                 

Gene name
TOR2, DRR2
Definition
(RefSeq) phosphatidylinositol kinase-related protein kinase TOR2
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
sce04136  Autophagy - other
sce04138  Autophagy - yeast
sce04139  Mitophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YKL203C (TOR2)
   04136 Autophagy - other
    YKL203C (TOR2)
   04139 Mitophagy - yeast
    YKL203C (TOR2)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YKL203C (TOR2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YKL203C (TOR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YKL203C (TOR2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YKL203C (TOR2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YKL203C (TOR2)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   YKL203C (TOR2)
Membrane trafficking [BR:sce04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    YKL203C (TOR2)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 HEAT HEAT_EZ Vac14_Fab1_bd TPR_19
Other DBs
NCBI-GeneID: 853632
NCBI-ProteinID: NP_012719
SGD: S000001686
UniProt: P32600
LinkDB
Structure
PDB: 
6EMK

Position
XI:complement(55935..63359)
AA seq 2474 aa
MNKYINKYTTPPNLLSLRQRAEGKHRTRKKLTHKSHSHDDEMSTTSNTDSNHNGPNDSGR
VITGSAGHIGKISFVDSELDTTFSTLNLIFDKLKSDVPQERASGANELSTTLTSLAREVS
AEQFQRFSNSLNNKIFELIHGFTSSEKIGGILAVDTLISFYLSTEELPNQTSRLANYLRV
LIPSSDIEVMRLAANTLGRLTVPGGTLTSDFVEFEVRTCIDWLTLTADNNSSSSKLEYRR
HAALLIIKALADNSPYLLYPYVNSILDNIWVPLRDAKLIIRLDAAVALGKCLTIIQDRDP
ALGKQWFQRLFQGCTHGLSLNTNDSVHATLLVFRELLSLKAPYLRDKYDDIYKSTMKYKE
YKFDVIRREVYAILPLLAAFDPAIFTKKYLDRIMVHYLRYLKNIDMNAANNSDKPFILVS
IGDIAFEVGSSISPYMTLILDNIREGLRTKFKVRKQFEKDLFYCIGKLACALGPAFAKHL
NKDLLNLMLNCPMSDHMQETLMILNEKIPSLESTVNSRILNLLSISLSGEKFIQSNQYDF
NNQFSIEKARKSRNQSFMKKTGESNDDITDAQILIQCFKMLQLIHHQYSLTEFVRLITIS
YIEHEDSSVRKLAALTSCDLFIKDDICKQTSVHALHSVSEVLSKLLMIAITDPVAEIRLE
ILQHLGSNFDPQLAQPDNLRLLFMALNDEIFGIQLEAIKIIGRLSSVNPAYVVPSLRKTL
LELLTQLKFSNMPKKKEESATLLCTLINSSDEVAKPYIDPILDVILPKCQDASSAVASTA
LKVLGELSVVGGKEMTRYLKELMPLIINTFQDQSNSFKRDAALTTLGQLAASSGYVVGPL
LDYPELLGILINILKTENNPHIRRGTVRLIGILGALDPYKHREIEVTSNSKSSVEQNAPS
IDIALLMQGVSPSNDEYYPTVVIHNLMKILNDPSLSIHHTAAIQAIMHIFQNLGLRCVSF
LDQIIPGIILVMRSCPPSQLDFYFQQLGSLISIVKQHIRPHVEKIYGVIREFFPIIKLQI
TIISVIESISKALEGEFKRFVPETLTFFLDILENDQSNKRIVPIRILKSLVTFGPNLEDY
SHLIMPIVVRMTEYSAGSLKKISIITLGRLAKNINLSEMSSRIVQALVRILNNGDRELTK
ATMNTLSLLLLQLGTDFVVFVPVINKALLRNRIQHSVYDQLVNKLLNNECLPTNIIFDKE
NEVPERKNYEDEMQVTKLPVNQNILKNAWYCSQQKTKEDWQEWIRRLSIQLLKESPSACL
RSCSSLVSVYYPLARELFNASFSSCWVELQTSYQEDLIQALCKALSSSENPPEIYQMLLN
LVEFMEHDDKPLPIPIHTLGKYAQKCHAFAKALHYKEVEFLEEPKNSTIEALISINNQLH
QTDSAIGILKHAQQHNELQLKETWYEKLQRWEDALAAYNEKEAAGEDSVEVMMGKLRSLY
ALGEWEELSKLASEKWGTAKPEVKKAMAPLAAGAAWGLEQWDEIAQYTSVMKSQSPDKEF
YDAILCLHRNNFKKAEVHIFNARDLLVTELSALVNESYNRAYNVVVRAQIIAELEEIIKY
KKLPQNSDKRLTMRETWNTRLLGCQKNIDVWQRILRVRSLVIKPKEDAQVRIKFANLCRK
SGRMALAKKVLNTLLEETDDPDHPNTAKASPPVVYAQLKYLWATGLQDEALKQLINFTSR
MAHDLGLDPNNMIAQSVPQQSKRVPRHVEDYTKLLARCFLKQGEWRVCLQPKWRLSNPDS
ILGSYLLATHFDNTWYKAWHNWALANFEVISMLTSVSKKKQEGSDASSVTDINEFDNGMI
GVNTFDAKEVHYSSNLIHRHVIPAIKGFFHSISLSESSSLQDALRLLTLWFTFGGIPEAT
QAMHEGFNLIQIGTWLEVLPQLISRIHQPNQIVSRSLLSLLSDLGKAHPQALVYPLMVAI
KSESLSRQKAALSIIEKMRIHSPVLVDQAELVSHELIRMAVLWHEQWYEGLDDASRQFFG
EHNTEKMFAALEPLYEMLKRGPETLREISFQNSFGRDLNDAYEWLMNYKKSKDVSNLNQA
WDIYYNVFRKIGKQLPQLQTLELQHVSPKLLSAHDLELAVPGTRASGGKPIVKISKFEPV
FSVISSKQRPRKFCIKGSDGKDYKYVLKGHEDIRQDSLVMQLFGLVNTLLQNDAECFRRH
LDIQQYPAIPLSPKSGLLGWVPNSDTFHVLIREHREAKKIPLNIEHWVMLQMAPDYDNLT
LLQKVEVFTYALNNTEGQDLYKVLWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDR
HPSNLMLDRITGKVIHIDFGDCFEAAILREKFPEKVPFRLTRMLTYAMEVSGIEGSFRIT
CENVMKVLRDNKGSLMAILEAFAFDPLINWGFDLPTKKIEEETGIQLPVMNANELLSNGA
ITEEEVQRVENEHKNAIRNARAMLVLKRITDKLTGNDIRRFNDLDVPEQVDKLIQQATSV
ENLCQHYIGWCPFW
NT seq 7425 nt   +upstreamnt  +downstreamnt
atgaataaatacattaacaaatacaccacgccacctaacttattgtctttacgacaaagg
gccgaaggcaaacacagaacaagaaagaaacttacacacaaatcgcactcccacgatgat
gagatgtcaactacttcaaacacagattccaatcacaatgggcccaatgactctggtaga
gtgatcactggttctgctggtcatattggtaaaatatcctttgtagattcagaactagat
acaacattttctactttaaatttgatttttgataaacttaaaagcgatgtgccacaagaa
cgagcctctggcgctaatgaattaagcactactttgacctcattagcaagggaagtatct
gctgagcaatttcaaaggtttagcaacagtttaaacaataagatatttgaacttattcac
gggtttacttcaagtgagaagataggtggtattcttgctgttgatactctgatctcattc
tacctgagtacagaggagctgccaaaccaaacttcaagactggcgaactatttacgtgtt
ttaattccatccagtgacattgaagttatgagattagcggctaacaccttaggtagattg
accgtgccaggtggtacattaacatcagatttcgtcgaatttgaggtcagaacttgcatt
gattggcttactctgacagcagataataactcatcgagctctaagttggaatacaggaga
catgctgcgctattaatcataaaggcattagcagacaattcaccctatcttttataccct
tacgttaactctatcttagacaatatttgggtgccattaagggatgcaaagttaattata
cgattagatgccgcagtggcattgggtaaatgtcttactattattcaggatagagaccct
gctttgggaaaacagtggtttcaaagattatttcaaggttgtacacatggcttaagtctc
aatacgaatgattcagtgcatgctactctgttggtatttcgagaattactcagcttgaaa
gcaccttatctcagggataaatatgatgatatttacaaatctactatgaagtacaaggaa
tataaatttgatgttataaggagagaagtttatgctattttacctcttttagctgctttt
gaccctgccattttcacaaagaaatatctcgataggataatggttcattatttaagatat
ttgaagaacatcgatatgaatgctgcaaataattcggataaaccttttatattagtttct
ataggtgatattgcatttgaagttggttcgagcatttcaccctatatgacacttattctg
gataatattagggaaggcttaagaacgaaattcaaagttagaaaacaattcgagaaggat
ttattttattgcattggtaaattagcttgtgctttgggcccagcttttgctaagcacttg
aacaaagatcttcttaatttgatgttaaactgtccaatgtccgaccatatgcaggagact
ttaatgatccttaacgagaaaataccctctttggaatctaccgttaattcgaggatacta
aatttactgtcgatatccttatctggtgaaaaatttattcaatcaaaccaatacgatttt
aataatcaattttccattgaaaaggctcgtaaatcaagaaaccaaagtttcatgaaaaaa
actggtgaatctaatgacgatattacagatgcccaaattttgattcagtgttttaaaatg
ctgcaactaattcatcatcaatattccttgacggagtttgttaggcttataaccatttct
tacattgagcatgaggattcgtctgtcagaaaattggcagcattaacgtcgtgtgattta
tttatcaaagacgatatatgtaaacaaacatcagttcatgctttacactcggtttctgaa
gtgctaagtaagctattaatgatcgcaataactgatccggttgcagaaattagattggaa
attcttcagcatttggggtcaaattttgatcctcaattggcccaaccagacaatttacgc
ctacttttcatggcgctgaacgatgagatttttggtattcaattggaagctatcaaaata
ataggcagattgagttctgtcaaccccgcttatgtagttccttctttgaggaaaacttta
ctggaactattaacgcaattgaagttctcaaatatgccaaaaaaaaaggaggaaagtgca
actctattatgtacgctgataaattccagcgatgaagtagcgaaaccttatattgatcct
attctagacgtcattcttcctaaatgccaggatgcttcatctgccgtagcatccaccgct
ttaaaggttttgggtgaactatctgttgttggaggaaaagaaatgacgcgttacttaaag
gaattgatgccattgatcattaacacatttcaggaccaatcaaactcttttaaaagagat
gccgccttaacaacattaggacagctggctgcttcctctggttatgttgttggcccttta
ctagactacccagagttacttggcattttgataaatattcttaagactgaaaacaaccct
catatcaggcgtggaactgttcgtttgattggtatattaggcgctcttgatccatataag
cacagagaaatagaagtcacatcaaactcaaagagttcagtagagcaaaatgctccttca
atcgacatcgcattgctaatgcaaggggtatctccatccaacgatgaatattaccccact
gtagttatccacaatctgatgaagatattgaatgatccatcgttgtcaatccatcacacg
gctgctattcaagctattatgcatatttttcaaaaccttggtttacgatgtgtctccttt
ttggatcaaattattccaggtatcattttagtcatgcgttcatgcccgccgtcccaactt
gacttttattttcagcaactgggatctctcatctcaattgtcaagcaacatattaggccc
catgtcgagaaaatttatggtgtgatcagggagtttttcccgatcattaaactacaaatc
acaattatttctgtcatagaatcgatatctaaggctctggaaggtgagtttaaaagattt
gttcccgagactctaacctttttccttgatattcttgagaacgaccagtctaataaaagg
atcgttccgattcgtatattaaaatctttggttacttttgggccgaatctagaagactat
tcccatttgattatgcctatcgttgttagaatgactgagtattctgctggaagtctaaag
aaaatctccattataactttgggtagattagcaaagaatatcaacctctctgaaatgtca
tcaagaattgttcaggcgttggtaagaattttgaataatggggatagagaactaacaaaa
gcaaccatgaatacgctaagtttgctccttttacaactaggtaccgactttgtggtcttt
gtgccagtgattaacaaggcgttattgaggaataggattcagcattcagtgtacgatcaa
ctggttaataaattactgaacaatgaatgcttgccaacaaatatcatatttgacaaggag
aacgaagtacctgaaaggaaaaattatgaagacgaaatgcaagtaacgaaattaccggta
aaccaaaatatcctaaagaatgcatggtattgttctcaacagaagaccaaagaagattgg
caagaatggataagaaggctatctattcagcttctaaaggaatcaccttcagcttgtcta
cgatcctgttcgagtttagtcagcgtttattatccgttggcgagagaattgtttaatgct
tcattctcaagttgctgggttgagcttcaaacgtcataccaagaggatttgattcaagca
ttatgcaaggctttatcatcctctgaaaacccacccgagatttatcaaatgttgttaaat
ttagtggaatttatggagcacgatgacaaaccattgcctatcccaatccatacattaggt
aagtatgcccaaaaatgtcatgcttttgcgaaggcactacattacaaagaggtagaattc
ttagaagagccgaaaaattcaacaatcgaggcattgattagcattaataatcaacttcac
caaactgattctgctattggtattttgaagcatgcgcaacaacacaatgaattgcagctg
aaggaaacttggtatgaaaaacttcaacgttgggaggatgctcttgcagcatataatgag
aaggaggcagcaggagaagattcggttgaagtgatgatgggaaaattaagatcgttatat
gcccttggagagtgggaagagctttctaaattggcatctgaaaagtggggcacggcaaaa
cccgaagtgaagaaggcaatggcgcctttggctgccggcgctgcctggggtttggagcaa
tgggatgaaatagcccagtatactagcgtcatgaaatcgcagtctccagataaagaattc
tatgatgcaattttatgtttgcataggaataattttaagaaggcggaagttcacatcttt
aatgcaagggatcttctagttactgaattgtcagctcttgttaatgaaagctacaataga
gcatataatgttgttgttagagcgcagattatagcagagttggaggaaatcatcaaatat
aagaagttgccacaaaattcagataaacgtctaactatgagagaaacttggaataccaga
ttactgggctgtcaaaaaaatattgatgtgtggcaaagaattctgcgtgtcagatcattg
gtgataaagccaaaggaggatgctcaagtgaggattaagtttgccaacttatgcagaaaa
tcgggtaggatggcgctagctaaaaaagtcttaaatacattgcttgaagaaacagatgac
ccagatcatcctaatactgctaaggcatcccctccagttgtttatgcacaactgaagtac
ttgtgggctacggggttgcaagatgaggctttgaagcaattaattaatttcacatctaga
atggctcatgatttaggtttggatccaaataatatgatagctcaaagcgttcctcaacaa
agcaaaagagtccctcgtcacgttgaagattatactaagcttttagctcgttgtttcttg
aagcaaggagaatggagagtttgcttacagcctaaatggagattgagcaatccagattcg
atcctaggctcctatttgctcgctacacattttgacaacacatggtacaaagcgtggcat
aactgggcactggccaattttgaagtcatttctatgctaacatctgtctctaaaaagaaa
caggaaggaagtgatgcttcctcggtaactgatattaatgagtttgataatggcatgatc
ggcgtcaatacatttgatgctaaggaagttcattactcttctaatttaatacacaggcac
gtaattccagcaattaagggtttttttcattccatttctttatcagaatcaagctctctt
caagatgcattaaggttattaactttatggtttacttttggtggtattccagaagcaacc
caagctatgcacgagggtttcaacctaatccaaataggcacatggttagaagtgttgcca
cagttaatttctagaattcatcaacccaatcaaattgttagtaggtcattactctcccta
ttatctgatctaggtaaggctcatccgcaggcattagtgtaccccttaatggttgcgatt
aaatccgaatctctctcacgacagaaagcagctttgtccatcatagaaaagatgagaata
catagtccagttttggtcgaccaggctgaacttgtcagccacgaattgatacgtatggcg
gtgctttggcatgagcaatggtatgagggtctggatgacgccagtaggcagttttttgga
gaacataataccgaaaaaatgtttgctgctttagagcctctgtacgaaatgctgaagaga
ggaccggaaactttgagggaaatatcgttccaaaattcttttggtagggacttgaatgac
gcttacgaatggctgatgaattacaaaaaatctaaagatgttagtaatttaaaccaagcg
tgggacatttactataatgttttcaggaaaattggtaaacagttgccacaattacaaact
cttgaactacaacatgtgtcgccaaaactactatctgcgcatgatttggaattggctgtc
cccgggacccgtgcaagtggtggaaaaccaattgttaaaatatctaaattcgagccagta
ttttcagtaatctcatccaaacaaagaccgagaaagttttgtatcaagggtagtgatggt
aaagattataagtatgtgttgaaaggacatgaagacattagacaggatagcttggtcatg
caattattcggactagttaacacgcttttgcaaaatgacgctgagtgctttagaaggcat
ctagatatccagcaatatccagcaatcccattatctccgaagtctgggttactgggttgg
gtaccgaatagtgacacgttccatgtattaattagggagcatagagaagccaaaaaaatt
cctttaaacattgagcattgggtcatgttacaaatggcacctgattatgacaatttaacg
ttgttgcagaaagtagaagtcttcacttacgccctaaataatacggagggacaagatctt
tataaggtgttatggctgaagagtaggtcatcggaaacgtggttggagcgtagaactact
tacactcgatcgctagccgtgatgtccatgaccggttatatattggggttaggtgaccgc
caccctagtaatttgatgttggatagaatcactgggaaagtcattcatattgattttggt
gattgtttcgaggctgctatattaagagaaaaattccccgaaaaagtaccttttagatta
actagaatgttaacatatgcaatggaagtgagtggaattgaaggtagcttccgtattact
tgtgagaatgttatgaaggtacttagagataacaagggttcattaatggcaatccttgaa
gcttttgctttcgatcctttgatcaattggggttttgacttaccaacaaagaaaattgag
gaagaaacgggcattcaacttcccgtgatgaatgccaatgagctattgagtaatggggct
attaccgaagaagaagttcaaagggtggaaaacgagcacaagaatgccattcgaaatgca
agggccatgttggtattgaagcgcattactgacaaattaacggggaacgatataagaagg
tttaatgacttggacgttccagaacaagtggataaactaatccaacaagccacatcagtg
gaaaacctatgccaacattatatcggttggtgtccattctggtag

DBGET integrated database retrieval system