KEGG   Saccharomyces cerevisiae (budding yeast): YJR104CHelp
Entry
YJR104C           CDS       T00005                                 

Gene name
SOD1, CRS4
Definition
(RefSeq) superoxide dismutase SOD1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04146  Peroxisome
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    YJR104C (SOD1)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    YJR104C (SOD1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YJR104C (SOD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 853568
NCBI-ProteinID: NP_012638
SGD: S000003865
UniProt: P00445
LinkDB All DBs
Structure
PDB: 

Position
X:complement(622550..623014)
Genome map
AA seq 154 aa AA seqDB search
MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVS
AGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVI
HAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagcagtcgcagtgttaaagggtgatgccggtgtctctggtgttgtcaagttc
gaacaggcttccgaatccgagccaaccactgtctcttacgagatcgctggtaacagtcct
aacgcagaacgtgggttccacattcatgagtttggagatgccaccaatggttgtgtctct
gctggtcctcacttcaatcctttcaagaagacacatggtgctccaactgacgaagtcaga
catgtcggtgacatgggtaacgtaaagacggacgaaaatggtgtggccaagggctccttc
aaggactctttgatcaagcttatcggtcctacctccgttgtaggcagaagcgtcgttatc
cacgccggccaagatgacttaggtaagggtgacactgaagaatctttgaagactggtaat
gccggtccaagaccagcctgtggtgtcattggtctaaccaactaa

DBGET integrated database retrieval system