KEGG   Saccharomyces cerevisiae (budding yeast): YKL062W
Entry
YKL062W           CDS       T00005                                 

Gene name
MSN4
Definition
(RefSeq) stress-responsive transcriptional activator MSN4
  KO
K09468  zinc finger protein MSN2/4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04113  Meiosis - yeast
sce04138  Autophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YKL062W (MSN4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YKL062W (MSN4)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YKL062W (MSN4)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YKL062W (MSN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YKL062W (MSN4)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 metabolic regulators in fungi
    YKL062W (MSN4)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_jaz zf-BED zf-C2H2_4 zf-C2HE IHABP4_N
Other DBs
NCBI-GeneID: 853803
NCBI-ProteinID: NP_012861
SGD: S000001545
UniProt: P33749
LinkDB
Position
XI:323228..325120
AA seq 630 aa
MLVFGPNSSFVRHANKKQEDSSIMNEPNGLMDPVLSTTNVSATSSNDNSANNSISSPEYT
FGQFSMDSPHRTDATNTPILTATTNTTANNSLMNLKDTASLATNWKWKNSNNAQFVNDGE
KQSSNANGKKNGGDKIYSSVATPQALNDELKNLEQLEKVFSPMNPINDSHFNENIELSPH
QHATSPKTNLLEAEPSIYSNLFLDARLPNNANSTTGLNDNDYNLDDTNNDNTNSMQSILE
DFVSSEEALKFMPDAGRDARRYSEVVTSSFPSMTDSRNSISHSIEFWNLNHKNSSNSKPT
QQIIPEGTATTERRGSTISPTTTINNSNPNFKLLDHDVSQALSGYSMDFSKDSGITKPKS
ISSSLNRISHSSSTTRQQRASLPLIHDIESFANDSVMANPLSDSASFLSEENEDDAFGAL
NYNSLDATTMSAFDNNVDPFNILKSSPAQDQQFIKPSMMLSDNASAAAKLATSGVDNITP
TPAFQRRSYDISMNSSFKILPTSQAHHAAQHHQQQPTKQATVSPNTRRRKSSSVTLSPTI
SHNNNNGKVPVQPRKRKSITTIDPNNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTER
PFACMFCEKKFSRSDNLSQHLKTHKKHGDF
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgctagtcttcggacctaatagtagtttcgttcgtcacgcaaacaagaaacaagaagat
tcgtctataatgaacgagccaaacggattgatggacccggtattgagcacaaccaacgtt
tctgctacttcttctaatgacaattctgcgaacaatagcatatcttcgccggaatatacc
tttggtcaattctcaatggattctccgcatagaacggacgccactaatactccaatttta
acagcgacaactaatacgactgctaataatagtttaatgaatttaaaggataccgccagt
ttagctaccaactggaagtggaaaaattccaataacgcacagttcgtgaatgacggtgag
aaacaaagcagtaatgctaatggtaagaaaaatggtggtgataagatatatagttcagta
gccacccctcaagctttaaatgacgaattgaaaaacttggagcaactagaaaaggtattt
tctccaatgaatcctatcaatgacagtcattttaatgaaaatatagaattatcgccacac
caacatgcaacttctcccaagacaaaccttcttgaggcagaaccttcaatatattccaat
ttgtttctagatgctaggttaccaaacaacgccaacagtacaacaggattgaacgacaat
gattataatctagacgataccaataatgataatactaatagcatgcaatcaatcttagag
gattttgtatcttcagaagaagcattgaagttcatgccggacgctggtcgcgacgcaaga
agatacagcgaggtggttacctcttcctttccttctatgacggattctagaaattcgatc
tctcattcgatagagttttggaatctcaatcacaaaaatagtagcaacagtaaacccact
caacaaattatccctgaaggtactgccactactgagaggcgtggatcaaccatttcacct
actaccactataaacaactctaatccaaacttcaaattattagatcatgacgtttctcaa
gctctgagcggttatagtatggatttttctaaggactctggtataacaaagccaaaaagc
atttcctcttctttaaatcgcatctcccatagcagtagcaccacaaggcaacagcgtgcc
tctttgcccttaattcatgatattgaatcttttgcaaatgattcggtgatggcaaatcct
ctgtctgattccgcatcatttctttcagaagaaaatgaagacgatgcttttggtgcgcta
aattacaatagcttagatgcaaccacaatgtcggcattcgacaataacgtagaccccttc
aacattctcaagtcatctccggctcaggatcaacagtttatcaaaccctctatgatgttg
tcggataatgcctctgctgccgctaaattggcgacttctggtgttgataatatcacacct
acaccagctttccaaagaagaagctatgatatctcgatgaactcttcgttcaaaatactt
cctactagtcaagctcaccatgcagctcaacatcatcaacaacaacctactaaacaggca
acggtaagcccaaacacaagaagaagaaagtcgtcaagtgttactttaagtccaactatt
tctcataacaacaacaatggtaaggttcctgtccaacctcggaaaaggaaatctattact
accattgaccccaacaactacgataaaaataaacctttcaagtgtaaagactgtgagaag
gcattcagacgcagtgagcacttgaaaaggcatataagatccgttcattcaacggaacgc
ccttttgcttgtatgttctgtgagaaaaaattcagtagaagtgacaatttatcacaacat
ctaaaaactcacaaaaagcacggtgatttttga

KEGG   Saccharomyces cerevisiae (budding yeast): YMR037C
Entry
YMR037C           CDS       T00005                                 

Gene name
MSN2
Definition
(RefSeq) stress-responsive transcriptional activator MSN2
  KO
K09468  zinc finger protein MSN2/4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04113  Meiosis - yeast
sce04138  Autophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YMR037C (MSN2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YMR037C (MSN2)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YMR037C (MSN2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YMR037C (MSN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YMR037C (MSN2)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 metabolic regulators in fungi
    YMR037C (MSN2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_4 zf-met zf-C2HE zf-BED zf-Di19
Other DBs
NCBI-GeneID: 855053
NCBI-ProteinID: NP_013751
SGD: S000004640
UniProt: P33748
LinkDB
Position
XIII:complement(344403..346517)
AA seq 704 aa
MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLDSADLNDIQNQ
ETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKNRDARTIENDSEIKSTNNASG
SGANQYTTLTSPYPMNDILYNMNNPLQSPSPSSVPQNPTINPPINTASNETNLSPQTSNG
NETLISPRAQQHTSIKDNRLSLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISN
SNSNSTGNLNSSYFNSLNIDSMLDDYVSSDLLLNDDDDDTNLSRRRFSDVITNQFPSMTN
SRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANADSNIAGNPKNN
DATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSFDANAMTKINPSQQLQQQLNRV
QHKQLTSSHNNSSTNMKSFNSDLYSRRQRASLPIIDDSLSYDLVNKQDEDPKNDMLPNSN
LSSSQQFIKPSMILSDNASVIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMA
PLSPASSSSTSLATNHFYHHFPQQGHHTMNSKIGSSLRRRKSAVPLMGTVPLTNQQNNIS
SSSVNSTGNGAGVTKERRPSYRRKSMTPSRRSSVVIESTKELEEKPFHCHICPKSFKRSE
HLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKHGDI
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgacggtcgaccatgatttcaatagcgaagatattttattccccatagaaagcatgagt
agtatacaatacgtggagaataataacccaaataatattaacaacgatgttatcccgtat
tctctagatatcaaaaacactgtcttagatagtgcggatctcaatgacattcaaaatcaa
gaaacttcactgaatttggggcttcctccactatctttcgactctccactgcccgtaacg
gaaacgataccatccactaccgataacagcttgcatttgaaagctgatagcaacaaaaat
cgcgatgcaagaactattgaaaatgatagtgaaattaagagtactaataatgctagtggc
tctggggcaaatcaatacacaactcttacttcaccttatcctatgaacgacattttgtac
aacatgaacaatccgttacaatcaccgtcaccttcatcggtacctcaaaatccgactata
aatcctcccataaatacagcaagtaacgaaactaatttatcgcctcaaacttcaaatggt
aatgaaactcttatatctcctcgagcccaacaacatacgtccattaaagataatcgtctg
tccttacctaatggtgctaattcgaatcttttcattgacactaacccaaacaatttgaac
gaaaaactaagaaatcaattgaactcagatacaaattcatattctaactccatttctaat
tcaaactccaattctacgggtaatttaaattccagttattttaattcactgaacatagac
tccatgctagatgattacgtttctagtgatctcttattgaatgatgatgatgatgacact
aatttatcacgccgaagatttagcgacgttataacaaaccaatttccgtcaatgacaaat
tcgaggaattctatttctcactctttggacctttggaaccatccgaaaattaatccaagc
aatagaaatacaaatctcaatatcactactaattctacctcaagttccaatgcaagtccg
aataccactactatgaacgcaaatgcagactcaaatattgctggcaacccgaaaaacaat
gacgctaccatagacaatgagttgacacagattcttaacgaatataatatgaacttcaac
gataatttgggcacatccacttctggcaagaacaaatctgcttgcccaagttcttttgat
gccaatgctatgacaaagataaatccaagtcagcaattacagcaacagctaaaccgagtt
caacacaagcagctcacctcgtcacataataacagtagcactaacatgaaatccttcaac
agcgatctttattcaagaaggcaaagagcttctttacccataatcgatgattcactaagc
tacgacctggttaataagcaggatgaagaccccaagaacgatatgctgccgaattcaaat
ttgagttcatctcaacaatttatcaaaccgtctatgattctttcagacaatgcgtccgtt
attgcgaaagtggcgactacaggcttgagtaatgatatgccatttttgacagaggaaggt
gaacaaaatgctaattctactccaaatttcgatctttccatcactcaaatgaatatggct
ccattatcgcctgcatcatcatcctccacgtctcttgcaacaaatcatttctatcaccat
ttcccacagcagggtcaccataccatgaactctaaaatcggttcttcccttcggaggcgg
aagtctgctgtgcctttgatgggtacggtgccgcttacaaatcaacaaaataatataagc
agtagtagtgtcaactcaactggcaatggtgctggggttacgaaggaaagaaggccaagt
tacaggagaaaatcaatgacaccgtccagaagatcaagtgtcgtaatagaatcaacaaag
gaactcgaggagaaaccgttccactgtcacatttgtcccaagagctttaagcgcagcgaa
catttgaaaaggcatgtgagatctgttcactctaacgaacgaccatttgcttgtcacata
tgcgataagaaatttagtagaagcgataatttgtcgcaacacatcaagactcataaaaaa
catggagacatttaa

DBGET integrated database retrieval system