KEGG   Saccharomyces cerevisiae (budding yeast): YKL148CHelp
Entry
YKL148C           CDS       T00005                                 

Gene name
SDH1
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit SDH1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00020  Citrate cycle (TCA cycle)
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Module
sce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YKL148C (SDH1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YKL148C (SDH1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YKL148C (SDH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 853709
NCBI-ProteinID: NP_012774
SGD: S000001631
UniProt: Q00711
LinkDB All DBs
Position
XI:complement(169207..171129)
Genome map
AA seq 640 aa AA seqDB search
MLSLKKSALSKLTLLRNTRTFTSSALVRQTQGSVNGSASRSADGKYHIIDHEYDCVVIGA
GGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNMHKDNWKWHMYDTVKG
SDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTENGKIYQRAFGGQTKEYGKGAQAYRT
CAVADRTGHALLHTLYGQALRHDTHFFIEYFALDLLTHNGEVVGVIAYNQEDGTIHRFRA
HKTIIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLITE
GARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEIREGRGVGKKKDHMYLQLS
HLPPEVLKERLPGISETAAIFAGVDVTKEPIPIIPTVHYNMGGIPTKWNGEALTIDEETG
EDKVIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTVADTLQPGLPHKPLPSD
LGKESIANLDKLRNANGSRSTAEIRMNMKQTMQKDVSVFRTQSSLDEGVRNITAVEKTFD
DVKTTDRSMIWNSDLVETLELQNLLTCASQTAVSAANRKESRGAHAREDYPNRDDEHWMK
HTLSWQKDVAAPVTLKYRRVIDHTLDEKECPSVPPTVRAY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgctatcgctaaaaaaatcagcgctctccaagttgactttgctcagaaacacaagaaca
tttacatcgtcagctttggtgcgccaaacgcagggctctgtaaacggttccgcgtccaga
tctgcagacgggaagtaccacataatagatcacgagtatgactgtgtggtaatcggtgcc
ggtggtgccggccttagagcggcctttggtcttgccgaggcgggctacaagactgcttgt
atatccaagcttttccccaccagatcccacactgttgctgctcagggtggtatcaatgcc
gctctgggaaatatgcacaaggataactggaaatggcatatgtacgatactgtgaaagga
tctgattggctaggtgaccaggactccatccattacatgaccagggaagcgcccaaatcg
atcattgaactggaacactatggtgttcctttttcaagaactgaaaacggtaagatctac
caaagagcctttggtggtcagaccaaggagtacggtaagggtgctcaggcctatagaaca
tgcgctgtcgcagacaggacaggacatgctcttttacacacgctttatggccaagcttta
agacatgacacacatttctttattgagtactttgccctcgatctgttgacccataatggc
gaggtcgttggtgtcatcgcttataatcaggaagacggtaccatccacagattcagagca
cacaagaccattattgccactggtggctatggtagagcatacttctcttgtacctctgct
cacacatgtacgggtgacggtaatgccatggtttcgcgtgctggtttccccttgcaagat
ttagagtttgttcaattccatccttcaggtatatatgggtctggttgcttaatcactgaa
ggtgctcgtggtgaaggtggttttttggttaattctgaaggtgaaagattcatggaacgt
tacgctcctacggccaaggatctagcttgtagagatgtcgtttccagagcaatcaccatg
gagatcagagaaggcagaggtgttggtaagaaaaaggaccacatgtacttacaattgagc
catctacctccggaagttctaaaggaaagattgccaggtatctctgaaacagcagccatt
tttgctggtgtagacgtcaccaaggaacctattcccattattcctaccgtccactataac
atgggtggtattcccacgaagtggaatggtgaggcattaaccattgatgaagaaactggc
gaagacaaggttattcccggtttaatggcttgtggtgaagccgcttgtgtttctgtccat
ggtgccaatagattaggtgccaattccttgttggatcttgttgtctttggtcgtgctgtt
gcccatacggttgctgacactttacagcctgggttgccacacaaaccactaccttctgat
ttgggtaaagaatccatcgcaaacttggataaactaagaaatgctaatggttcaagatct
acggcagaaattagaatgaatatgaaacaaactatgcaaaaggatgtttccgtctttaga
acacaatcatctttagatgaaggtgttcggaacattactgcagtagagaagacctttgat
gatgtgaagacgaccgatagatcaatgatctggaattctgacttggttgaaactctggag
ctacagaacttattaacctgtgcctcccaaacagctgtttccgctgctaatagaaaggaa
tcccgtggtgctcatgcaagagaggattatccaaatagagatgacgaacattggatgaag
catacattatcctggcaaaaggacgtcgctgccccagtgactttgaaatacagaagggtt
atcgatcacactttggacgaaaaggaatgtccttccgtacctccaactgtaagagcctac
taa

DBGET integrated database retrieval system