KEGG   Saccharomyces cerevisiae (budding yeast): YKL193CHelp
Entry
YKL193C           CDS       T00005                                 

Gene name
SDS22, EGP1
Definition
(RefSeq) type 1 protein phosphatase-activating protein SDS22
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YKL193C (SDS22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6 LRR_1 LRR_5 2H-phosphodiest
Motif
Other DBs
NCBI-GeneID: 853641
NCBI-ProteinID: NP_012728
SGD: S000001676
UniProt: P36047
LinkDB All DBs
Position
XI:complement(78866..79882)
Genome map
AA seq 338 aa AA seqDB search
MDKNSVNKDSEEKDERHKIEVVDDTNPDFITADSELTQDLPDDVEVIDLVHLKIKSLEDL
NLYRFKNLKQLCLRQNLIESISEVEVLPHDKIVDLDFYDNKIKHISSNVNKLTKLTSLDL
SFNKIKHIKNLENLTDLENLYFVQNSISKIENLSTLKSLKNLELGGNKVHSIEPDSFEGL
SNLEEIWLGKNSIPRLINLHPLKNLKILSIQSNKLKKIENLEELTNLEELYLSHNFITKI
EGLEKNLKLTTLDVTSNKITSLENLNHLSNLTDIWASFNKIDQSFESLGENLSALSRLET
IYLEGNPIQLENKTSYRRKLTMNLPPSLQKIDATYIRG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggataagaattcagttaacaaagatagtgaagaaaaagacgaaagacacaagattgag
gttgtagacgatacaaatcctgacttcatcactgcagattcggaactgacacaagatctg
cctgatgatgtagaggttattgacttggtccatctaaaaatcaaatcgttagaagatttg
aacctttataggttcaagaatttgaaacaattatgtctcagacagaacctgatcgaaagc
ataagcgaagtggaagttttaccccatgacaagattgttgaccttgatttttacgataac
aaaattaaacatatctcctctaatgttaataagctcaccaaattaacgtctctagacctg
tcgtttaacaagatcaagcacatcaaaaatctagaaaatttgactgatctggagaattta
tacttcgtgcagaacagcatttccaaaattgaaaatctgtccactttgaaatcactgaaa
aacttagaattaggtggtaataaggttcattctattgaacccgattccttcgaaggtctg
tcaaacttggaagaaatttggttgggtaaaaattccataccaagacttattaacttacat
cctttaaagaatttgaagatattgtccatccaatctaataaattaaaaaaaattgaaaat
ctagaagagttgaccaatcttgaagagctctatctgtcacataatttcatcaccaagatt
gaaggtctagagaaaaacctaaaactaactactttggacgtgacctccaacaaaattacc
tccctggaaaacttgaaccacctgtcaaatttaactgacatatgggcctcctttaacaag
atagatcaatcctttgagagcttgggtgaaaacctgtccgccctatcacgcttggagacc
atttatctggagggaaaccctattcaactggaaaataagacttcgtatagaagaaaactg
actatgaacttacctccatccctacagaagattgatgcgacatatataagaggctga

DBGET integrated database retrieval system