KEGG   Saccharomyces cerevisiae (budding yeast): YLL041CHelp
Entry
YLL041C           CDS       T00005                                 

Gene name
SDH2, ACN17
Definition
(RefSeq) succinate dehydrogenase iron-sulfur protein subunit SDH2
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00020  Citrate cycle (TCA cycle)
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Module
sce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sce_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YLL041C (SDH2)
  Energy metabolism
   00190 Oxidative phosphorylation
    YLL041C (SDH2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YLL041C (SDH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-GeneID: 850685
NCBI-ProteinID: NP_013059
SGD: S000003964
UniProt: P21801
LinkDB All DBs
Position
XII:complement(53131..53931)
Genome map
AA seq 266 aa AA seqDB search
MLNVLLRRKAFCLVTKKGMATATTAAATHTPRLKTFKVYRWNPDEPSAKPHLQSYQVDLN
DCGPMVLDALLKIKDEQDSTLTFRRSCREGICGSCAMNIGGRNTLACICKIDQNESKQLK
IYPLPHMFIVKDLVPDLTNFYQQYKSIQPYLQRSSFPKDGTEVLQSIEDRKKLDGLYECI
LCACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDQATKTRKAMLNNSMSLYRCHTIM
NCTRTCPKGLNPGLAIAEIKKSLAFA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacgtgctattgagaaggaaggccttttgtttggtgacgaagaagggtatggct
actgccacaacagctgcagctacgcatacccccagattgaaaacttttaaagtttacaga
tggaatccagacgagccaagtgctaaacctcatttacagtcatatcaagtggatctgaat
gactgtgggcccatggtacttgatgcgctgttaaagatcaaagacgaacaggattctacc
ctaacttttagaagatcatgtagagaaggtatctgcggttcatgtgccatgaacattggc
ggtagaaacacgctagcttgtatatgtaagatcgaccagaacgaatccaaacaactcaag
atctatccattaccccacatgtttattgtcaaagatttggtacctgatttaactaacttc
taccaacaatacaaatctatccaaccttacttacagagatcatcgtttccaaaggatgga
acggaagtgctacaaagtattgaagatcgtaagaaactggatggtctttacgaatgtatt
ctgtgtgcatgctgctctacttcatgtccatcgtactggtggaaccaagaacagtatttg
ggccctgccgtgctaatgcaagcctaccgttggctaattgactctagagaccaagctaca
aagacaagaaaggccatgctaaacaactccatgtcattgtacagatgtcacaccatcatg
aactgtactagaacttgtccaaagggcttgaatcctggtttggctattgctgaaattaag
aaatctttggcatttgcctag

DBGET integrated database retrieval system