KEGG   Saccharomyces cerevisiae (budding yeast): YLR079W
Entry
YLR079W           CDS       T00005                                 

Gene name
SIC1, BYC1, SDB25
Definition
(RefSeq) cyclin-dependent protein serine/threonine kinase inhibiting protein SIC1
  KO
K03085  substrate and inhibitor of the cyclin-dependent protein kinase CDC28
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YLR079W (SIC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLR079W (SIC1)
   04113 Meiosis - yeast
    YLR079W (SIC1)
SSDB
Other DBs
NCBI-GeneID: 850768
NCBI-ProteinID: NP_013180
SGD: S000004069
UniProt: P38634
LinkDB
Position
XII:286820..287674
AA seq 284 aa
MTPSTPPRSRGTRYLAQPSGNTSSSALMQGQKTPQKPSQNLVPVTPSTTKSFKNAPLLAP
PNSNMGMTSPFNGLTSPQRSPFPKSSVKRTLFQFESHDNGTVREEQEPLGRVNRILFPTQ
QNVDIDAAEEEEEGEVLLPPSRPTSARQLHLSLERDEFDQTHRKKIIKDVPGTPSDKVIT
FELAKNWNNNSPKNDARSQESEDEEDIIINPVRVGKNPFASDELVTQEIRNERKRAMLRE
NPDIEDVITYVNKKGEVVEKRRLTDEEKRRFKPKALFQSRDQEH
NT seq 855 nt   +upstreamnt  +downstreamnt
atgactccttccaccccaccaaggtccagagggactaggtaccttgcgcagcctagtggc
aatactagttctagtgccctaatgcaaggtcaaaagaccccccaaaagccttcacagaac
ctagtccctgtcactccctcaacaactaagtcttttaaaaatgcgccattattagcacct
cccaattcgaacatgggtatgacctctccatttaatgggcttacgtctcctcaacgctcg
ccgtttccaaaatcttcagtgaagaggacactattccaatttgaaagtcatgataatgga
acagtaagggaagagcaggaaccattgggtcgtgtaaataggatattgtttcccacgcag
caaaatgtggatatagatgcagcagaagaagaagaagaaggagaagttcttcttcccccc
agcagacctacatctgccaggcagttacatttatcacttgaaagagatgagtttgatcag
acacatagaaagaagattattaaagatgtacctggtacgcccagcgacaaggtgataaca
tttgaattggcaaaaaattggaacaacaactctccgaaaaatgacgccaggagtcaagaa
agtgaagacgaggaagacatcatcatcaatccagtgcgggtgggtaaaaatccctttgca
tcagatgaactggtcactcaggaaattagaaatgaacgtaaaagggcaatgttgagagaa
aacccagatatagaagacgtaataacatatgtcaataagaagggagaggtggtagagaaa
cgaaggttaacggatgaagaaaagagaagattcaagccaaaggcattgtttcaatctagg
gatcaagagcattga

DBGET integrated database retrieval system