KEGG   Saccharomyces cerevisiae (budding yeast): YLR288C
Entry
YLR288C           CDS       T00005                                 

Gene name
MEC3, PIP3, PSO9
Definition
(RefSeq) Mec3p
  KO
K02544  G2-specific checkpoint protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLR288C (MEC3)
   04113 Meiosis - yeast
    YLR288C (MEC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YLR288C (MEC3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    YLR288C (MEC3)
SSDB
Motif
Pfam: Hus1
Other DBs
NCBI-GeneID: 850995
NCBI-ProteinID: NP_013391
SGD: S000004279
UniProt: Q02574
LinkDB
Position
XII:complement(713480..714904)
AA seq 474 aa
MKLKLIVNGCEAPDDYKLLRTTINTVASLRKTAILRFNSERLTIISTPKSSLNSSNNGTI
LRGDTGQLWCTIPHDVFRLYTVISARELNTITMECNCDSLLSVFKRYDRVMNQGSSSNMT
IKLQSMPEWNTNNGTLSGGTAGGVDTTSKPNPICALGITFEEIVHTSGPNDAIVMNGGVD
EHNGLPTTVGTGNLLASNKVIMHSFKVPVKLLFRAQDTRIQEPMINYIQLMMYKLPPISG
EFGSAFHGFIRRVERYSNVNHIHLMGVKKKEHGNEGDDVELKIIVNELDWHLEICWNGPL
DSVIQRQEGLTDNPSQNQHIDTDGRQEEGSLPIIEADKPMSSLYTNTRDREMEENIRYDE
DLLRIEDSSIADTRGNIYTADTSGDTEFNDISVMVEKAEQESSSTHEVIIRCKDWKVCSK
LYAAFEEVVLAISHDESCVFHCSLDRGSLEDSEDVEKPRERGQIIYYIARSKGL
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaaattaaaattgatagtaaatggttgtgaagcacctgatgattataaattgctaaga
actactatcaatacagttgcttcgctacgaaagacggctatcttaagatttaatagtgaa
agattgacaataatatccactccaaaatcatcactcaacagcagtaacaacggtacaata
ttacgaggggatactggtcagctttggtgtaccattcctcatgatgtattcagattatat
acagttatatcagctcgcgagctcaatacaataacaatggagtgtaattgtgattcttta
ttgagtgtgtttaaaaggtatgatcgagtaatgaaccaaggatcttcctctaatatgact
ataaaactacagtcaatgccagaatggaatacaaataacggaacactttcaggaggaaca
gcaggaggcgtagatacaacctcaaaaccgaaccccatttgtgctctaggtataacattc
gaagaaattgtacatactagcggcccaaatgacgctatagttatgaatgggggagtggat
gagcacaatggtttaccaaccacagtaggcacaggaaatctactcgcaagcaataaggtt
atcatgcattcgttcaaagtacctgtcaaactattattccgagcacaagatacgcgaata
caagagccaatgattaactatattcaactgatgatgtacaagctgccaccaatatcgggc
gagtttggctccgccttccacgggtttattagacgtgttgaacggtacagtaatgtcaac
cacattcatttaatgggagtcaaaaaaaaggagcatggaaatgaaggtgatgatgtagaa
cttaagataattgtgaatgaattagattggcatttggaaatatgctggaatggaccctta
gactctgtgatacaacgccaagaagggctcactgacaatccttcccaaaaccagcacatc
gacacagacggccggcaggaggaaggatctcttccgattatcgaagcggataaaccgatg
tcttcactatataccaatactagagatcgagagatggaagaaaatatccgctacgatgaa
gatttattaagaattgaggatagctcgatcgcagatacgcggggaaacatttacacagct
gatactagcggtgatactgaatttaatgacatatccgttatggtggaaaaggctgaacag
gaaagttcgtccacacatgaagtaatcatccgttgcaaagattggaaggtgtgttccaag
ttatacgctgcatttgaagaagttgttttggcgatttctcacgacgaatcctgcgtattc
cactgttcgttggatcgtggtagcttggaagatagcgaagatgtggaaaaaccaagggaa
agaggacaaatcatatattatatagcaagatcgaagggcttgtaa

DBGET integrated database retrieval system