KEGG   Saccharomyces cerevisiae (budding yeast): YLR448WHelp
Entry
YLR448W           CDS       T00005                                 

Gene name
RPL6B
Definition
(RefSeq) ribosomal 60S subunit protein L6B
  KO
K02934  large subunit ribosomal protein L6e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YLR448W (RPL6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YLR448W (RPL6B)
Ribosome [BR:sce03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    YLR448W (RPL6B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L6e
Motif
Other DBs
NCBI-GeneID: 851169
NCBI-ProteinID: NP_013553
SGD: S000004440
UniProt: P05739
LinkDB All DBs
Position
XII:join(1028854..1028868,1029253..1029768)
Genome map
AA seq 176 aa AA seqDB search
MTAQQAPKWYPSEDVAAPKKTRKAVRPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLED
NTLLVTGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKFNVEYFAKEKLTKKEKKEAN
LFPEQQTKEIKTERVEDQKVVDKALLAEIKKTPLLKQYLSASFSLKNGDKPHLLKF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccaacaagccccaaagtggtatccttccgaagacgttgctgccccaaagaaa
accagaaaggctgttcgcccacaaaagttgcgtgcctctctagttccaggcactgttttg
atcttgctagctggccgtttcagaggtaagagagttgtctacttgaaacatctagaagac
aacactctattggtcactggtccattcaaggtcaatggtgttccattgagaagagtcaac
gctcgttatgtcattgctacctctaccaaagtctccgtggaaggtgtcaacgttgaaaaa
ttcaacgttgaatactttgccaaggaaaaattgaccaagaaggaaaagaaggaagctaac
ttgttcccagaacaacaaactaaggaaatcaagactgaacgtgttgaagatcaaaaggtt
gttgacaaggctttgttggctgaaatcaagaagaccccattgttgaagcaatatttgtcc
gcttctttctctttgaagaacggtgacaagccacacctattgaaattctaa

DBGET integrated database retrieval system