KEGG   Saccharomyces cerevisiae (budding yeast): YML065W
Entry
YML065W           CDS       T00005                                 

Gene name
ORC1
Definition
(RefSeq) origin recognition complex subunit 1
  KO
K02603  origin recognition complex subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YML065W (ORC1)
   04113 Meiosis - yeast
    YML065W (ORC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YML065W (ORC1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YML065W (ORC1)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YML065W (ORC1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     YML065W (ORC1)
SSDB
Motif
Pfam: AAA_lid_10 BAH AAA AAA_22 AAA_16 ATPase_2 AAA_18 AAA_19 NACHT RNA_helicase DUF3222 SDA1
Other DBs
NCBI-GeneID: 854937
NCBI-ProteinID: NP_013646
SGD: S000004530
UniProt: P54784
LinkDB
Structure
PDB: 

Position
XIII:142210..144954
AA seq 914 aa
MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKLGRGDSVVMHN
EAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYN
KLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPT
GEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAE
TRATDITDNEDGNEDESSDYESPSDIDVSEDMDSGEISADELEEEEDEEEDEDEEEKEAR
HTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLLISSCRANNTPVIRKF
TKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFYGNSSELMASRFENKLKTTQKHQIVE
TIFSKVKKQLNSSYVKEEILKSANFQDYLPARENEFASIYLSAYSAIESDSATTIYVAGT
PGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWA
ASMESLEFYFKRVPKNKKKTIVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVAN
TMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRLKGLNDSFFYVDTKTGNAILI
DAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAEKH
YMAKHGYGYDGKTVIEDENEEQIYDDEDKDLIESNKAKDDNDDDDDNDGVQTVHITHVMK
ALNETLNSHVITFMTRLSFTAKLFIYALLNLMKKNGSQEQELGDIVDEIKLLIEVNGSNK
FVMEIAKTLFQQGSDNISEQLRIISWDFVLNQLLDAGILFKQTMKNDRICCVKLNISVEE
AKRAMNEDETLRNL
NT seq 2745 nt   +upstreamnt  +downstreamnt
atggcaaaaacgttgaaggatttacagggttgggagataataacaactgatgagcaggga
aatataatcgatggaggtcagaagagattacgccgaagaggtgcaaaaactgaacattac
ttaaagagaagttctgatggaattaaactaggtcgtggtgatagtgtagtcatgcacaac
gaagccgctgggacttactccgtttatatgatccaggagttgagacttaatacattaaat
aatgttgtcgaactctgggctctcacctatttacgatggtttgaagtcaatcctttagct
cattataggcagtttaatcctgacgctaacattttgaatcgtcctttaaattattacaat
aaactgttttctgaaactgcaaataaaaatgaactgtatctcactgcagaattagccgaa
ttgcagctatttaactttatcagggttgccaacgtaatggatggaagcaaatgggaagta
ttgaaaggaaatgtcgatccagaaagagactttacagttcgttatatttgtgagccgact
ggggagaaatttgtggacattaatattgaggatgtcaaagcttacataaagaaagtggag
ccaagggaagcccaggaatatttgaaagatttaacacttccatcaaagaagaaagagatc
aaaagaggtcctcaaaagaaagataaggctactcaaacggcacaaatttcagacgcagaa
acaagagctacagatataacggataatgaggacggtaatgaagatgaatcatctgattat
gaaagtccgtcagatatcgacgttagcgaggatatggacagcggtgaaatatccgcagat
gagcttgaggaagaagaagacgaagaagaagacgaagacgaagaagagaaagaagctagg
catacaaattcaccaaggaaaagaggccgtaagataaaactaggtaaagatgatattgac
gcttctgtacaacctccccccaaaaaaagaggtcgtaaacctaaagatcctagtaaaccg
cgtcagatgctattgatatcttcatgccgtgcaaataatactcctgtgattaggaaattt
acaaaaaagaatgttgctagggcgaaaaagaaatataccccgttttcgaaaagatttaaa
tctatagctgcaataccagatttaacttcattacctgaattttacggaaattcttcggaa
ttgatggcatcaaggtttgaaaacaaattaaaaacaacccaaaagcatcagattgtagaa
acaattttttctaaagtcaaaaaacagttgaactcttcgtatgtcaaagaagaaatattg
aagtctgcaaatttccaagattatttaccggctagggagaatgaattcgcctcaatttat
ttaagtgcatatagtgccattgagtccgactccgctactactatatacgtggctggtacg
cctggtgtagggaaaactttaaccgtaagggaagtcgtaaaggaactactatcgtcttct
gcacaacgagaaataccagactttctttatgtggaaataaatggattgaaaatggtaaaa
cccacagactgttacgaaactttatggaacaaagtgtcaggagaaaggttaacatgggca
gcttcaatggagtcactagagttttactttaaaagagttccaaaaaataagaagaaaacc
attgtagtcttgttggacgaactcgatgccatggtaacgaaatctcaagatattatgtac
aattttttcaattggactacttacgaaaatgccaaacttattgtcattgcagtagccaat
acaatggacttaccagaacgtcagctaggcaataagattacttcaagaattgggtttacc
agaattatgttcactgggtatacgcacgaagagctaaaaaatatcattgatttaagactg
aaggggttgaacgactcatttttctatgttgatacaaaaactggcaatgctattttgatt
gatgcggctggaaacgacactacagttaagcaaacgttgcctgaagacgtgaggaaagtt
cgcttaagaatgagtgctgatgccattgaaatagcttcgagaaaagtagcaagtgttagt
ggtgatgcaagaagagcattgaaggtttgtaaaagagcagctgaaattgctgaaaaacac
tatatggctaagcatggttatggatatgatggaaagacggttattgaagatgaaaatgag
gagcaaatatacgatgatgaagacaaggatcttattgaaagtaacaaagccaaagacgat
aatgatgacgatgatgacaatgatggggtacaaacagttcacatcacgcacgttatgaaa
gccttaaacgaaactttaaattctcatgtaattacgtttatgacgcgactttcatttaca
gcaaaactgtttatttatgcattattaaacttgatgaaaaagaacggatctcaagagcaa
gaactgggcgatattgtcgatgaaatcaagttacttattgaagtaaatggcagtaataag
tttgtcatggagatagccaaaacattgttccaacagggaagtgataatatttctgaacaa
ttgagaattatatcatgggatttcgttctcaatcagttacttgacgcgggaatattgttt
aaacaaactatgaagaacgatagaatatgttgtgtcaagctaaatatatcagtagaagaa
gccaaaagagccatgaatgaggatgagacattgagaaatttatag

DBGET integrated database retrieval system