KEGG   Saccharomyces cerevisiae (budding yeast): YML085CHelp
Entry
YML085C           CDS       T00005                                 

Gene name
TUB1
Definition
(RefSeq) alpha-tubulin TUB1
  KO
K07374  tubulin alpha
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    YML085C (TUB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YML085C (TUB1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YML085C (TUB1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YML085C (TUB1)
   04147 Exosome [BR:sce04147]
    YML085C (TUB1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     YML085C (TUB1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     YML085C (TUB1)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    YML085C (TUB1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YML085C (TUB1)
  Exosomal proteins of other body fluids (saliva and urine)
   YML085C (TUB1)
  Exosomal proteins of colorectal cancer cells
   YML085C (TUB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 854889
NCBI-ProteinID: NP_013625
SGD: S000004550
UniProt: P09733
LinkDB All DBs
Structure
PDB: 

Position
XIII:complement(join(97941..99259,99376..99400))
Genome map
AA seq 447 aa AA seqDB search
MREVISINVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGEEGFSTFFHETGYG
KFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVL
DRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVST
SVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVT
ASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPG
NQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEP
PTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFT
EAREDLAALERDYIEVGADSYAEEEEF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagttattagtattaatgtcggtcaagctggttgtcagattggtaatgcctgt
tgggaattatattcccttgagcacggtattaagccggatggacatctagaagatggcctt
tcaaagccgaagggaggagaagagggtttctccacgtttttccatgaaaccggctacggt
aagttcgttccaagggctatttacgtggatttagagcccaacgttattgacgaagtccgt
aacggtccttacaaggacttgttccatccagaacagttgatcagtggtaaggaggacgcg
gctaataattatgcaagaggccattacaccgttggtagagaaattttgggcgatgttctg
gataggattagaaaactggcagaccaatgtgatgggttacaagggttcttgtttacccat
tctcttggtggtggtactggttccggtctagggtccttactgttggaagaactatccgct
gaatacggtaagaaatccaagctggaatttgccgtataccctgctccacaagtgtctact
tctgtggttgagccttacaacacagttttaactacacatactacattggaacatgcagat
tgtactttcatggtcgataatgaggctatttacgacatgtgcaaaagaaacttggatatc
ccaagaccaagctttgcaaacttaaacaacctaattgctcaagtggtatcatctgttaca
gcatcattgagattcgacggttcattaaatgtagatttgaacgaatttcaaaccaatttg
gttccatatccaagaattcatttccccttagtttcatattctccagtcttatccaaatca
aaggcattccatgagtccaactctgtgtcagaaattacaaacgcttgttttgaacctggt
aaccagatggtcaagtgtgatccaagagatggtaaatacatggctacttgtctgttatac
aggggtgatgtggtaacaagagatgttcaaagagctgtcgagcaggtgaaaaacaagaag
accgtccaattggttgattggtgtccaactggtttcaagatcggtatttgctacgaacct
ccaactgccacaccaaactcacaattggccactgtggatagggccgtctgtatgttgtca
aataccacatccattgctgaggcttggaagagaatcgatagaaaattcgatttaatgtat
gccaaacgtgctttcgtccactggtatgtcggtgaaggtatggaagaaggtgaattcacc
gaagctagagaagatttggctgctttagaaagagattacatcgaagtgggtgccgactca
tacgctgaggaagaggaattttaa

DBGET integrated database retrieval system