KEGG   Saccharomyces cerevisiae (budding yeast): YML124CHelp
Entry
YML124C           CDS       T00005                                 

Gene name
TUB3
Definition
(RefSeq) alpha-tubulin TUB3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 854915
NCBI-ProteinID: NP_013582
SGD: S000004593
UniProt: P09734
LinkDB All DBs
Position
XIII:complement(join(22048..23360,23659..23683))
Genome map
AA seq 445 aa AA seqDB search
MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYG
KFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVE
ERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLST
SVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVT
ASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPG
NQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEP
PSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFT
EAREDLAALERDYIEVGADSYAEEF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggtcattagtattaatgttggtcaagcaggttgtcaaataggtaatgcatgc
tgggaattgtactccctagagcatggcatcaaggaagacggccatttggaggatggcttg
tcaaaacctaagggaggtgaagaaggattttctacattcttccatgaaacggggtacgga
aaattcgtcccaagagcaatctacgtggatttagagcccaatgttatcgatgaagtacgt
acaggacgtttcaaggagcttttccatccagaacaattgattaacggtaaggaagatgcc
gccaataactacgcaagaggccattatacagtgggtagagaaatagtggatgaagttgaa
gaaagaattagaaagatggccgaccaatgtgacggtttacaagggttcttgttcacccac
tccctcggtggtggaactggttccggtttaggttccctgttattagaaaacttatcgtat
gaatacgggaagaaatccaaattggaattcgccgtttatcctgcgcctcaattgtctact
tccgtcgtggaaccttacaacacggttttaaccacgcataccaccctggaacacgcagac
tgtacgtttatggtcgataacgaagccatttacgatatatgcaagaggaacttgggaatt
tctagaccaagcttcagcaacttgaacgggttgattgcccaagtgatatcatctgttaca
gcctctttgaggttcgatggttcattaaacgtggatttgaacgaatttcagaccaacttg
gtaccatatccaagaattcatttccctttggtttcctacgcacccatcttgtccaagaag
agggccacccatgaatccaactccgtgtcagaaatcacaaacgcttgtttcgaaccgggc
aatcaaatggttaagtgtgacccaacaaaggggaagtacatggctaactgtttgttatac
agaggtgacgtggtgaccagagatgtccaaagagccgtcgaacaggtgaagaataaaaaa
acagtacaaatggtggattggtgtccaacaggatttaagattggtatttgttatgagcca
ccaagtgtgataccaagttccgaattagccaatgtggatagagctgtctgcatgctatcc
aacaccactgccatcgcggacgcttggaagagaatcgatcagaaattcgacctgatgtat
gccaaacgtgctttcgtccattggtatgtcggtgaaggtatggaagaaggtgagttcacc
gaagctagagaagatttagctgccttagaaagagattatattgaagtgggtgccgattct
tacgctgaggagttctaa

DBGET integrated database retrieval system