KEGG   Saccharomyces cerevisiae (budding yeast): YMR016C
Entry
YMR016C           CDS       T00005                                 

Gene name
SOK2
Definition
(RefSeq) Sok2p
  KO
K12763  enhanced filamentous growth protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YMR016C (SOK2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YMR016C (SOK2)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Other transcription factors
   Others
    YMR016C (SOK2)
SSDB
Motif
Pfam: KilA-N
Other DBs
NCBI-GeneID: 855030
NCBI-ProteinID: NP_013729
SGD: S000004618
UniProt: P53438
LinkDB
Position
XIII:complement(303236..305593)
AA seq 785 aa
MPIGNPINTNDIKSNRMRQESNMSAVSNSESTIGQSTQQQQQQQQYLGQSVQPLMPVSYQ
YVVPEQWPYPQYYQQPQSQSQQQLQSQPQMYQVQESFQSSGSDSNASNPPSTSVGVPSNA
TATALPNGSAITTKKSNNSTNISNNVPYYYYFPQMQAQQSMAYSYPQAYYYYPANGDGTT
NGATPSVTSNQVQNPNLEKTYSTFEQQQQHQQQQQLQAQTYPAQPPKIGNAFSKFSKSGP
PSDSSSGSMSPNSNRTSRNSNSISSLAQQPPMSNYPQPSTYQYPGFHKTSSIPNSHSPIP
PRSLTTPTQGPTSQNGPLSYNLPQVGLLPPQQQQQVSPLYDGNSITPPVKPSTDQETYLT
ANRHGVSDQQYDSMAKTMNSFQTTTIRHPMPLIATTNATGSNTSGTSASIIRPRVTTTMW
EDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHVVKIGSM
HLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQNNPSNDSSSSSSSTGIKSISP
RTYYQPINNYQNPNGPSNISAAQLTYSSMNLNNKIIPNNSIPAVSTIAAGEKPLKKCTMP
NSNQLEGHTITNLQTLSATMPMKQQLMGNIASPLSYPRNATMNSASTLGITPADSKPLTP
SPTTTNTNQSSESNVGSIHTGITLPRVESESASHSKWSKEADSGNTVPDNQTLKEPRSSQ
LPISALTSTDTDKIKTSTSDEATQPNEPSEAEPVKESESSKSQVDGAGDVSNEEIAADDT
KKQEK
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgcccatcggtaacccaatcaatacgaatgatatcaagtccaaccgcatgcgccaggaa
tcaaatatgagtgccgtgagcaatagcgaaagtactattggccagtccacccaacagcag
cagcaacaacaacaatatctcggccagagcgttcaacctctgatgcccgtatcctaccaa
tacgtagttcctgaacagtggccgtacccgcaatattatcagcagccgcaatcccagtct
caacagcaactgcaatcccagcctcagatgtatcaagttcaagaatcctttcagagtagc
ggttctgactcaaatgcttccaatccaccttccacgtctgtaggtgttccttccaacgct
actgcaactgcgttaccgaatggttctgcaatcaccaccaaaaaaagcaataacagtact
aatatcagtaacaatgtaccatactactattattttccccaaatgcaagcccaacaatca
atggcatattcgtatccacaagcgtattattattatcctgcaaacggcgatggaaccact
aacggtgcaacaccatctgtaaccagtaatcaagtccaaaaccccaatttggaaaaaacc
tactcaacctttgaacaacagcaacaacaccagcagcaacaacaattacaagctcaaacg
tatccggcccaaccaccaaagataggtaatgcattttcaaagttcagtaaatctggacca
ccttctgattcgtccagtggctctatgtctcccaattctaatcgcactagtcgcaatagt
aatagtatctcgtccttagctcagcagcctccaatgtcaaactatccacaaccttccacc
taccaataccccggttttcacaagacttcgtcaattccaaactcgcattctccaattcct
ccaagatcattaacaacgccaactcaaggtccaaccagccaaaatggacctttaagctac
aatcttccgcaagtgggtttgctaccgcctcagcaacaacaacaggtgagcccgttgtat
gatggaaattctataactccaccagttaaaccctctactgatcaagaaacttatttaact
gcaaataggcacggagtgtcagatcaacagtatgactcaatggctaaaaccatgaattct
ttccaaacaactaccataaggcacccgatgcccttaatcgccactaccaatgccacaggc
agtaacaccagcggcacttcggcaagtataataaggccaagagtaacaacaacaatgtgg
gaggatgaaaaaacgctatgttatcaggtagaagctaacggtatttcagtggtaagaaga
gcagataatgatatggttaatggtaccaaacttctgaatgtaactaagatgacaagaggt
agaagagatggtattctaaaagcggaaaaaatcaggcatgtggtgaagattggttccatg
catttgaagggtgtctggataccgtttgagcgtgccctagcaatagcacaaagagaaaaa
attgctgactatctttatcccttgttcatcagggatattcagagcgtattgaaacaaaat
aatccaagcaatgatagcagtagtagtagcagtagcactggtattaaatccatcagtccg
cgtacctattatcaacctattaacaactatcaaaatcctaatggtccttcaaatatatct
gctgctcagctgacatactcctcaatgaatttgaacaacaaaattatacccaataattct
ataccagctgtaagtacaatcgctgcgggtgaaaagcccttgaaaaaatgcacaatgcct
aactctaaccaactagaaggacatactataactaacctacagaccctttcggcaacaatg
ccgatgaaacaacaactgatgggcaacatagcttcacccttatcgtatccacgcaacgcc
acaatgaattcggcaagtacattaggcattacacctgcagattcaaagcctttgacacct
tctccaactacaacaaacacaaatcaatcatctgaatcaaatgtgggaagtatccataca
ggaatcacccttccaagagtggaatctgaatcggcatcacattccaaatggtctaaggaa
gcagacagtgggaatactgtaccagataatcaaacattaaaggagccacgatctagtcaa
ttaccaatctccgcattgacttcgacggatactgacaaaataaaaacaagtacaagcgat
gaagcaacacaaccgaacgaacctagtgaagcagaacctgtcaaggagtcagagtcatcc
aaatcacaagttgatggagctggcgatgtctccaacgaagaaattgctgctgatgataca
aaaaaacaagaaaaatag

DBGET integrated database retrieval system