KEGG   Saccharomyces cerevisiae (budding yeast): YMR250WHelp
Entry
YMR250W           CDS       T00005                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase GAD1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00250  Alanine, aspartate and glutamate metabolism
sce00410  beta-Alanine metabolism
sce00430  Taurine and hypotaurine metabolism
sce00650  Butanoate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Module
sce_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    YMR250W (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YMR250W (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YMR250W (GAD1)
   00430 Taurine and hypotaurine metabolism
    YMR250W (GAD1)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     YMR250W (GAD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 855291
NCBI-ProteinID: NP_013976
SGD: S000004862
UniProt: Q04792
LinkDB All DBs
Position
XIII:770801..772558
Genome map
AA seq 585 aa AA seqDB search
MLHRHGSKQKNFENIAGKVVHDLAGLQLLSNDVQKSAVQSGHQGSNNMRDTSSQGMANKY
SVPKKGLPADLSYQLIHNELTLDGNPHLNLASFVNTFTTDQARKLIDENLTKNLADNDEY
PQLIELTQRCISMLAQLWHANPDEEPIGCATTGSSEAIMLGGLAMKKRWEHRMKNAGKDA
SKPNIIMSSACQVALEKFTRYFEVECRLVPVSHRSHHMLDPESLWDYVDENTIGCFVILG
TTYTGHLENVEKVADVLSQIEAKHPDWSNTDIPIHADGASGGFIIPFGFEKEHMKAYGME
RWGFNHPRVVSMNTSGHKFGLTTPGLGWVLWRDESLLADELRFKLKYLGGVEETFGLNFS
RPGFQVVHQYFNFVSLGHSGYRTQFQNSLFVARAFSFELLNSSKLPGCFEIVSSIHESIE
NDSAPKSVKDYWEHPQAYKPGVPLVAFKLSKKFHEEYPEVPQAILSSLLRGRGWIIPNYP
LPKATDGSDEKEVLRVVFRSEMKLDLAQLLIVDIESILTKLIHSYEKVCHHIELASEQTP
ERKSSFIYEMLLALASPQDDIPTPDEIEKKNKLKETTTRNYRGTC
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgttacacaggcacggttctaagcagaagaacttcgagaatatcgctggaaaagttgtc
cacgaccttgcaggtctgcaattgctttctaacgacgttcaaaaatccgctgtccaaagt
ggtcatcaaggatcgaacaatatgagagatacttcgtctcagggcatggctaataagtat
tcagttccaaaaaagggactacctgctgatttgtcttaccaactgattcataatgaatta
acacttgatggtaatccgcatttgaaccttgccagtttcgtgaacacttttaccactgat
caggcaaggaaattgattgatgaaaatttgaccaaaaatcttgctgacaatgatgaatat
ccgcaattaattgagctaactcagcgttgtatttctatgctagctcaattatggcacgct
aatcccgatgaagaaccaataggctgtgccaccacaggttctagtgaggcaatcatgttg
ggtggactcgccatgaaaaaaagatgggaacacagaatgaagaatgctggtaaagatgct
tccaagccgaacattataatgtcttctgcgtgccaagtggcattagagaagtttacgaga
tattttgaagtggaatgccgattggttccggtatcccacagaagccatcatatgcttgac
ccagagtcgttatgggattatgtagatgagaacactattggctgttttgtaattttagga
accacctacactggccatttggaaaatgtagagaaagttgcagatgtcttgtcccaaatt
gaggccaagcatcctgattggagcaatactgatattccaatccatgcggatggcgcttca
ggtgggtttattatcccatttggctttgaaaaagagcacatgaaagcttatggcatggaa
cgttgggggttcaaccatccgcgtgtggttagtatgaacactagtggtcataagtttggc
ttaaccactcccggtctgggttgggtgctatggagagatgaatccttactggctgatgaa
ttgagattcaaactaaagtacctcggtggcgtggaagaaactttcggtttgaatttttca
agacctggatttcaagttgtccatcaatacttcaattttgtttctctaggccattcaggg
tatagaacacaattccaaaattctctatttgttgcaagagcgttttctttcgaattattg
aattcgtcaaaattgcccggatgctttgaaattgttagcagtatccatgaaagcattgag
aacgattccgcccctaagtcagttaaagactattgggaacacccccaggcttacaaacca
ggtgtaccgctggtagccttcaaattgtccaagaaattccacgaagaatatccagaagtg
ccacaagcaatcctttcctctttactgagaggtaggggttggataataccaaattaccca
ctaccaaaggcaacggatggatccgatgagaaggaggtattaagagtggttttcagatcg
gagatgaagttggatttagcacagttgttgatcgttgacatcgagagtatcttgacaaag
ttgattcatagttacgaaaaggtttgtcatcatatagaacttgcctctgagcaaactcca
gagcgcaagagttcgttcatctacgaaatgttgctggcattggcatctccacaagatgac
atcccaacgccggatgaaatcgaaaagaaaaataagctaaaggaaacaacaacgagaaac
tatagaggaacatgttga

DBGET integrated database retrieval system