KEGG   Saccharomyces cerevisiae (budding yeast): YNL098C
Entry
YNL098C           CDS       T00005                                 

Gene name
RAS2, CTN5, CYR3, GLC5, TSL7
Definition
(RefSeq) Ras family GTPase RAS2
  KO
K07827  GTPase KRas
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
sce04138  Autophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YNL098C (RAS2)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YNL098C (RAS2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YNL098C (RAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YNL098C (RAS2)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sce04031]
    YNL098C (RAS2)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    YNL098C (RAS2)
GTP-binding proteins [BR:sce04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    YNL098C (RAS2)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 855625
NCBI-ProteinID: NP_014301
SGD: S000005042
UniProt: P01120
LinkDB
Position
XIV:complement(439602..440570)
AA seq 322 aa
MPLNKSNIREYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVVIDDEVSIL
DILDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQILRVKDTDYVPIVV
VGNKSDLENEKQVSYQDGLNMAKQMNAPFLETSAKQAINVEEAFYTLARLVRDEGGKYNK
TLTENDNSKQTSQDTKGSGANSVPRNSGGHRKMSNAANGKNVNSSTTVVNARNASIESKT
GLAGNQATNGKTQTDRTNIDNSTGQAGQANAQSANTVNNRVNNNSKAGQVSNAKQARKQQ
AAPGGNTSEASKSGSGGCCIIS
NT seq 969 nt   +upstreamnt  +downstreamnt
atgcctttgaacaagtcgaacataagagagtacaagctagtcgtcgttggtggtggtggt
gttggtaaatctgctttgaccatacaattgacccaatcgcactttgtagatgaatacgat
cccacaattgaggattcatacaggaagcaagtggtgattgatgatgaagtgtctatattg
gacattttggatactgcagggcaggaagaatactctgctatgagggaacaatacatgcgc
aacggcgaaggattcctattggtttactctataacgtccaagtcgtctcttgatgagctt
atgacttactatcaacagatattgagagtcaaagataccgactatgttccaattgtggtt
gttggtaacaaatctgatttagaaaacgaaaaacaggtctcttaccaggacgggttgaac
atggcaaagcaaatgaacgctcctttcttggagacatctgctaagcaagcaatcaacgtg
gaagaggcgttttacactctagcacgtttagttagagacgaaggcggcaagtacaacaag
actttgacggaaaatgacaactccaagcaaacttctcaagatacaaaagggagcggtgcc
aactctgtgcctagaaatagcggtggccacaggaagatgagcaatgctgccaacggtaaa
aatgtgaacagtagcacaactgtcgtgaatgccaggaatgcaagcatagagagtaagaca
gggttggcaggcaaccaggcgacaaatggtaagacacaaactgatcgcaccaatatagac
aattccacgggccaagctggtcaggccaacgctcaaagcgctaatacggttaataatcgt
gtaaataataatagtaaggccggtcaagtttcaaatgctaaacaggctaggaagcagcaa
gctgcacccggcggtaacaccagtgaagcctccaagagcggatcgggtggctgttgtatt
ataagttaa

KEGG   Saccharomyces cerevisiae (budding yeast): YOR101W
Entry
YOR101W           CDS       T00005                                 

Gene name
RAS1
Definition
(RefSeq) Ras family GTPase RAS1
  KO
K07827  GTPase KRas
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
sce04138  Autophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YOR101W (RAS1)
  09143 Cell growth and death
   04113 Meiosis - yeast
    YOR101W (RAS1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YOR101W (RAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YOR101W (RAS1)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sce04031]
    YOR101W (RAS1)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    YOR101W (RAS1)
GTP-binding proteins [BR:sce04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    YOR101W (RAS1)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 GTP_EFTU Menin MMR_HSR1_Xtn FeoB_N
Other DBs
NCBI-GeneID: 854268
NCBI-ProteinID: NP_014744
SGD: S000005627
UniProt: P01119
LinkDB
Position
XV:515244..516173
AA seq 309 aa
MQGNKSTIREYKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVVIDDKVSIL
DILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVKDSDYIPVVV
VGNKLDLENERQVSYEDGLRLAKQLNAPFLETSAKQAINVDEAFYSLIRLVRDDGGKYNS
MNRQLDNTNEIRDSELTSSATADREKKNNGSYVLDNSLTNAGTGSSSKSAVNHNGETTKR
TDEKNYVNQNNNNEGNTKYSSNGNGNRSDISRGNQNNALNSRSKQSAEPQKNSSANARKE
SSGGCCIIC
NT seq 930 nt   +upstreamnt  +downstreamnt
atgcagggaaataaatcaactataagagagtataagatagtagttgtcggtggaggtggc
gttggtaaatctgctttaacaattcaattcattcaatcatactttgtggacgaatatgac
cctactatcgaagattcttacagaaaacaagttgtcatcgatgacaaagtatccattttg
gacattctagatactgctggacaagaagagtattctgcgatgagagaacagtacatgagg
actggggaaggtttcctactggtctattccgtcacctctagaaattcctttgatgagtta
ctgtcttattatcagcaaattcaaagagtaaaagattctgactacattcctgtagtcgtg
gtaggtaacaaattggaccttgaaaatgaaagacaagtctcttatgaagacgggttacgc
ctggccaagcagttgaatgcaccctttctagaaacgtctgcgaaacaagccatcaacgta
gacgaggccttttatagccttattcgtttggtaagggacgacggtgggaaatacaatagc
atgaatcgtcaactggataatacgaatgaaataagagattcggagctaacctcatctgca
acagcggatagagaaaaaaagaacaacgggtcttatgtactcgataattctttgaccaat
gctggcactggctccagttcaaagtcagccgttaaccataacggtgaaactactaaacga
actgatgaaaagaattacgttaatcaaaacaataacaatgaaggaaataccaagtactcc
agtaacggcaacggaaatcgaagtgatattagtcgtggtaatcaaaataatgccttaaat
tcgagaagtaaacagtctgctgagccacaaaaaaattcaagcgccaacgctagaaaagaa
tctagtggtggttgttgtataatttgttga

DBGET integrated database retrieval system