KEGG   Saccharomyces cerevisiae (budding yeast): YNL261W
Entry
YNL261W           CDS       T00005                                 

Gene name
ORC5
Definition
(RefSeq) origin recognition complex subunit 5
  KO
K02607  origin recognition complex subunit 5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YNL261W (ORC5)
   04113 Meiosis - yeast
    YNL261W (ORC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YNL261W (ORC5)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YNL261W (ORC5)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YNL261W (ORC5)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YNL261W (ORC5)
SSDB
Motif
Pfam: ORC5_C AAA_22 AAA_16 AAA_19
Other DBs
NCBI-GeneID: 855460
NCBI-ProteinID: NP_014138
SGD: S000005205
UniProt: P50874
LinkDB
Structure
PDB: 
5ZR1 5V8F

Position
XIV:155100..156539
AA seq 479 aa
MNVTTPEVAFREYQTNCLASYISADPDITPSNLILQGYSGTGKTYTLKKYFNANPNLHAV
WLEPVELVSWKPLLQAIARTVQYKLKTLYPNIPTTDYDPLQVEEPFLLVKTLHNIFVQYE
SLQEKTCLFLILDGFDSLQDLDAALFNKYIKLNELLPKDSKINIKFIYTMLETSFLQRYS
THCIPTVMFPRYNVDEVSTILVMSRCGELMEDSCLRKRIIEEQITDCTDDQFQNVAANFI
HLIVQAFHSYTGNDIFALNDLIDFKWPKYVSRITKENIFEPLALYKSAIKLFLSTDDNLS
ENGQGESAITTNRDDLENSQTYDLSIISKYLLIASYICSYLEPRYDASIFSRKTRIIQGR
AAYGRRKKKEVNPRYLQPSLFAIERLLAIFQAIFPIQGKAESGSLSALREESLMKANIEV
FQNLSELHTLKLIATTMNKNIDYLSPKVRWKVNVPWEIIKEISESVHFNISDYFSDIHE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaatgtgaccactccggaagttgcttttagggaatatcaaaccaactgtctcgcatcg
tatatttctgctgatccagacataactccttcaaatttaatcttgcaaggttatagtgga
acaggaaaaacctacactttgaagaagtattttaatgcgaatccaaatttgcatgcagta
tggctggaacctgttgagttggtttcttggaagcccttactgcaggcgatagcacgtact
gtacaatataaattgaaaaccctatatccaaacattcccaccacagattacgatccttta
caggttgaagagccatttcttttggtaaagacgttgcacaatatttttgtccaatatgaa
tctttgcaagaaaagacttgcttgttcttgatattggatggtttcgatagtttacaagat
ttagacgccgcactgtttaacaaatatatcaaactaaatgaattacttccaaaagattct
aaaattaatataaaattcatttacacgatgttagagacatcatttttgcaaagatattct
acacattgcattccaactgttatgtttccgaggtataatgtggacgaagtttctactata
ttagtgatgtctagatgtggcgaactcatggaagattcttgtctacgtaagcgtatcatt
gaagagcagataacggactgtacagacgatcaatttcaaaatgtagctgcgaacttcatt
cacttaattgtgcaggcttttcattcttatactggaaacgacatattcgcattgaatgac
ttgatagacttcaaatggcccaagtatgtatctcgcattactaaggaaaacatatttgaa
ccactggctctttacaaaagtgccatcaaactatttttaagcacagatgataatttaagt
gaaaatggacaaggtgaaagcgcgataaccacaaatcgtgatgaccttgagaacagtcaa
acttacgacttatcaataatttcgaagtatctgctcatagcctcatatatttgttcatat
ctggaacctagatacgatgcgagtattttctctaggaaaacacgtatcatacaaggtaga
gctgcttatggacgaagaaagaagaaagaagttaaccctagatatttacagccttcttta
tttgctattgaaagacttttggctattttccaagctatattccctattcaaggtaaggcg
gagagtggttccctatctgcacttcgtgaggaatccttaatgaaagcgaatatcgaggtt
tttcaaaatttatccgaattgcatacattgaaattaatagctacaaccatgaacaagaat
atcgactatttgagtcctaaagtcaggtggaaagtaaacgttccctgggaaattattaaa
gaaatatcagaatctgttcatttcaatatcagcgattacttcagcgatattcacgaatga

DBGET integrated database retrieval system