KEGG   Saccharomyces cerevisiae (budding yeast): YOR073W
Entry
YOR073W           CDS       T00005                                 

Gene name
SGO1, YOR29-24
Definition
(RefSeq) Sgo1p
  KO
K11582  shugoshin
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YOR073W (SGO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YOR073W (SGO1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    Shugoshin
     YOR073W (SGO1)
SSDB
Motif
Pfam: Shugoshin_N Shugoshin_C TSC22 FHIPEP
Other DBs
NCBI-GeneID: 854240
NCBI-ProteinID: NP_014716
SGD: S000005599
UniProt: Q08490
LinkDB
Position
XV:464771..466543
AA seq 590 aa
MPKRKIAPNKESSRRTVSHDDLTPQIQEFQNLMDLESQKVENIRQSYSRQNSLLAKDNSI
LKIKVNSLEKKISQLVQENVTLRSKTSISEAIYRERLSNQLQVIENGIIQRFDEIFYMFE
NVRKNENLPSSSLRTMLKRTSSRSRSCSLSSPTYSKSYTRLSNHENNLSHESSFNKDDGP
DLEPKAKKRKSSRRQSMFVSTSLEPEDETGENEPMMENSSVEVPAESHESAQVEETIDAL
NPEEENSDSVSNFTNSIIEYSIPEENPTEPEHSSSKLEIFNDSTNMLSTVPSNPLPLPLP
GPSATLPTTTSDASTVYPSSSSSTNSHPKTKIKHSMKPPRIELKKKVIDEVMPVSNMSSN
SEISFTRTRRTRGKAVDYTLPSLRAKMRRPSEKLVDATTVIDIHDLQVSKRNRETSHKRK
SLSQDSIPDEPQLREVVVSKDYGTPKGKKTEDEIHEDTAHLMTTSNNNSNNKNEKKLTSN
NSPKKSSPLLDITNKSENKKKSTRTKKLFKNAIVNNLSDENSTTRPSKSSKGTSNNNNNY
NNFDNNNSNINNVNNKSVSFRLNEDDLAVFDLFGNGKAVKHQPKTYRTKK
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgccgaagagaaaaattgctcctaacaaggaaagcagcaggcgtacggtctcccacgat
gatttaaccccacaaatacaagaatttcaaaacctaatggatctcgaatcgcaaaaagtg
gaaaacatcagacagtcgtattcgaggcaaaactccctgctggccaaggataactccata
ttaaaaattaaagttaatagcttggaaaaaaaaataagccagctggtacaagaaaacgtg
actctacgatctaaaacctctataagcgaagctatctacagggaacggttaagtaatcaa
ctacaagtcattgaaaacggtattattcaaagatttgacgaaattttttatatgtttgag
aacgtacgtaaaaacgaaaatttgcccagttcgagcttaagaacaatgttgaagagaacg
agttccaggtcaagatcatgctcattgtcatcacccacatactcaaaaagttacactagg
ttatcaaatcacgagaataacctgtcgcatgaatcaagttttaacaaggacgatggtcca
gatcttgagcctaaggctaaaaaaaggaagagttctaggcggcaatctatgtttgtatcc
acgagtttagaacctgaagacgaaaccggtgaaaacgaacccatgatggaaaattcctct
gtagaggtaccggcagaatcacacgagtctgcgcaagtggaggaaacaatagatgcctta
aaccctgaagaggaaaatagcgattctgtcagtaattttaccaattcaattatagaatac
tccataccagaggagaatccgacagaacccgagcattcatcttctaaactagaaatattc
aatgacagtacaaatatgctaagtacagtgccgtcaaatcctttgccgttgcctttacca
ggcccatccgcaactttacctactaccactagcgatgcttcaacggtctatccttcatca
agttcttctactaattctcatccaaagaccaaaattaagcattccatgaagccgcctagg
atagaactgaagaaaaaggttattgacgaagtcatgcccgtaagtaacatgagcagcaac
agcgaaatatcatttacgagaactagaagaactcgtggtaaagctgtagattacactttg
ccttctttaagagccaaaatgaggaggccttcagaaaaacttgtggatgctactactgtg
attgatatacatgatctacaggtttccaagagaaatcgggaaacttcacataaaaggaaa
agtttatcccaagattcaatacccgacgaaccgcaattgagagaagtcgtcgtctcaaag
gattatggaactccaaaagggaaaaaaacggaagatgaaatacacgaggataccgctcat
ctaatgaccacttccaacaacaacagcaacaacaaaaacgaaaaaaaactaactagcaac
aatagccctaaaaaatcgtcgcctttacttgacattacaaataaatcggagaataagaaa
aagtcaacaagaactaaaaaattgttcaaaaatgcaattgtcaataatttatctgatgaa
aattctactacgcgaccctccaagtcgtcaaagggaaccagtaataataacaacaattac
aacaatttcgacaataacaattcaaacattaataatgttaataataaatctgttagcttt
agactaaatgaagatgatttagcagtatttgatttatttggaaatggtaaggcagtgaaa
catcaaccaaaaacatatcgcaccaaaaaatga

DBGET integrated database retrieval system