KEGG   Saccharomyces cerevisiae (budding yeast): YOR313C
Entry
YOR313C           CDS       T00005                                 

Gene name
SPS4
Definition
(RefSeq) Sps4p
  KO
K12772  sporulation-specific protein 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YOR313C (SPS4)
SSDB
Motif
Pfam: Perilipin_2 RIG-I_C
Other DBs
NCBI-GeneID: 854490
NCBI-ProteinID: NP_014958
SGD: S000005840
UniProt: P09937
LinkDB
Position
XV:complement(901858..902874)
AA seq 338 aa
MPSNLNIVKVTKPQEENKNFLHKNTNEPNEMEQSQTQEAVTENFTENSNLSANEHAARRG
RLNLKTVDHIETYPIVQETEEIAKKIALTRIILAQTKPRIDKVVVSRPVQAVAPVVNFFD
KMANSTLSTVERVVPSLKTKTYKRLGEEIALPYTLSKKYGKQLRDTTARNGDNYVYQPVH
GRLMKFRKYYNEKFIDTKGKPLIRGQLDPVLLPVNNTFEKVTVKYLPKGKKVPNDSFSCE
FNRGLALEYNFMTRAVSAVSHQVVGIAKLPIAYGYHTNSVYNKNLDKQADLKMKNVLRGT
WDTITDLEREIWASVTDRSLFRFFGNKSEGGDLPHLVQ
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgccatcaaatttgaatatagtgaaggttacaaaaccacaagaagaaaataagaatttt
ttacacaaaaacacgaatgaacccaatgaaatggaacaatcgcagacacaagaagcagtt
acagaaaattttaccgaaaacagtaatctcagtgcaaatgaacatgcagctaggaggggt
agattaaatttgaaaacagttgatcacatagaaacttatccaatagtgcaagaaacagaa
gagattgcaaagaagattgctctaacgagaattattttagcacaaacaaagcctagaatc
gataaagtggtagtgtcacgtcccgttcaagccgtagcaccagtggtcaatttttttgac
aagatggccaattcgactttaagtacagtagagcgcgttgtcccttctttgaaaacaaaa
acttataaaagattaggtgaggaaattgcacttccgtatactttgtcgaaaaagtatgga
aagcagctcagggatacgacagcaagaaatggagacaactatgtttaccaacctgtccat
ggaaggttgatgaaatttaggaagtactataatgaaaaattcatagacacaaagggcaag
cctttgataagggggcaacttgaccctgttttgttaccagtcaataatacattcgaaaag
gtaacggtaaagtatttgcccaaaggtaagaaagttccaaatgattccttttcttgtgag
tttaatagggggctagctttagaatacaattttatgacaagagcagtttctgcagttagt
catcaagttgttggtattgcaaagcttcccattgcctatggatatcatacaaactctgtt
tataataaaaacttagacaaacaggccgatttaaaaatgaaaaatgtattgagaggtact
tgggataccataactgatttagaacgcgaaatttgggcctctgtcaccgatagaagtttg
tttagattttttggcaacaaatctgagggaggagatttaccacatctagtacaataa

DBGET integrated database retrieval system