KEGG   Saccharomyces cerevisiae (budding yeast): YOR351C
Entry
YOR351C           CDS       T00005                                 

Gene name
MEK1, MRE4
Definition
(RefSeq) serine/threonine protein kinase MEK1
  KO
K12776  meiosis-specific serine/threonine-protein kinase MEK1 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YOR351C (MEK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YOR351C (MEK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YOR351C (MEK1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   YOR351C (MEK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Pkinase_fungal Kinase-like Yop-YscD_cpl Kdo
Other DBs
NCBI-GeneID: 854533
NCBI-ProteinID: NP_014996
SGD: S000005878
UniProt: P24719
LinkDB
Structure
PDB: 
5YYX 5YYZ

Position
XV:complement(995018..996511)
AA seq 497 aa
MRPLYSCNLATKDDIEMAGGVAPAHLEVNVGGYNTEQTIPIVKHQLVKVGRNDKECQLVL
TNPSISSVHCVFWCVFFDEDSIPMFYVKDCSLNGTYLNGLLLKRDKTYLLKHCDVIELSQ
GSEENDIKKTRLVFMINDDLQSSLDPKLLDQMGFLREVDQWEITNRIVGNGTFGHVLITH
NSKERDEDVCYHPENYAVKIIKLKPNKFDKEARILLRLDHPNIIKVYHTFCDRNNHLYIF
QDLIPGGDLFSYLAKGDCLTSMSETESLLIVFQILQALNYLHDQDIVHRDLKLDNILLCT
PEPCTRIVLADFGIAKDLNSNKERMHTVVGTPEYCAPEVGFRANRKAYQSFSRAATLEQR
GYDSKCDLWSLGVITHIMLTGISPFYGDGSERSIIQNAKIGKLNFKLKQWDIVSDNAKSF
VKDLLQTDVVKRLNSKQGLKHIWIAKHLSQLERLYYKKILCNNEGPKLESINSDWKRKLP
KSVIISQAIPKKKKVLE
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgagaccgttgtatagctgcaaccttgcaaccaaagatgatattgagatggcaggtggc
gtagctcctgctcacctggaagttaatgtaggcggctataatacagagcagacaatacct
atagtaaagcatcagctcgtgaaagttgggagaaatgataaggaatgtcaactcgttcta
acgaatccctctatctcctctgttcattgcgtgttttggtgtgtcttttttgatgaggat
agtattccaatgttctacgttaaagattgttctcttaatggaacgtatttgaacggtttg
cttttgaaaagggacaaaacgtatcttttaaaacattgcgacgttattgaattatcgcag
ggaagtgaagaaaatgacattaaaaaaacacgactagtttttatgattaatgatgattta
caatcttctctggacccaaaacttttagatcaaatgggttttctgagggaagtagaccaa
tgggaaataacaaatagaatagtgggtaatggcactttcggtcatgttctgatcacgcat
aactcaaaagaacgtgatgaagatgtctgttatcaccctgaaaattatgctgtgaagatc
attaaactaaaaccaaataaattcgataaagaggctcgaatccttttgagactggatcac
ccaaatattatcaaagtctaccatactttctgtgacaggaacaatcacctttacatattc
caggatcttatccctggtggtgatttgttttcttacctagctaaaggcgactgtctaact
tccatgtcagaaactgaatcgctattgatcgtctttcaaattttgcaagctttaaactac
cttcatgatcaagacattgttcaccgcgatttgaaactagacaatattttgttatgtacg
ccagaaccgtgcactagaatcgtcttggcagactttggtatagctaaagatttaaattcc
aacaaagaaagaatgcatactgtcgtaggcactccggaatactgcgctccagaagttgga
ttcagagcaaacagaaaagcatatcaaagcttctcaagagcagctacgttagagcaacga
ggttatgacagtaaatgtgatctttggtctttgggtgtcattacacacattatgttaaca
gggatctcgcctttttatggagatggttctgagaggagtattattcaaaatgcaaaaatt
gggaagctgaatttcaaactgaagcagtgggatattgtttcagataatgccaagagtttt
gtcaaagaccttttgcaaactgacgtagttaaacgattaaatagtaagcaaggtctcaaa
catatttggattgcaaaacacttaagtcaattagagagattatattacaaaaagatattg
tgcaataacgaaggccctaaactagaaagtataaattcagactggaaaaggaagttaccc
aaaagtgttatcatttctcaggcaataccgaaaaagaagaaggttttggagtaa

DBGET integrated database retrieval system