KEGG   Saccharomyces cerevisiae (budding yeast): YPL116WHelp
Entry
YPL116W           CDS       T00005                                 

Gene name
HOS3
Definition
(RefSeq) histone deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     YPL116W (HOS3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     YPL116W (HOS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 855987
NCBI-ProteinID: NP_015209
SGD: S000006037
UniProt: Q02959
LinkDB All DBs
Position
XVI:329606..331699
Genome map
AA seq 697 aa AA seqDB search
MSSKHSDPLERFYKQFQAFVQNNPNVISAARAAAQIPESAKAVVVLSPYSLQHVFPREWV
TKSYRKTIVERPERLLASSMGISAAITMYPSLFTLKSSHQRKGSLMAPHVLKVHGSSWPA
ELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETGVDSIFKGPSAE
HISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTYNVTHVVVLDFDLHHGDGT
QDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNA
STCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFFRSAKLEMNQQGRPFK
GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHCHGKVLSLMEGGYSD
KAICSGVFAHLIGLQNQDWVKEWGSEQVVKEIVRGCKPAWKPYKTKRAKDVIRIWAEEVI
RLGRAMIPEFDDIIFKDAVNSAPSNSLLKATVEPASTSTIAQRIIRSHRSNASPEKELHE
NKPRSTEKQEQREIRSDTKVKQLSSNNRAAETQIPFLQQEFSSEDEDEEYVYDEELNKTF
NRTVEDITIDDISRHLETLEIEKKGDEDSDHELKEKNWKNSHQRRLQGNGMYKIPSNTKP
HRIRQPQNANTPTYDDSDISMISHVSRKHTTRSGGRW
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaagcattcagatccattggagagattttataagcaatttcaagcatttgtt
caaaataaccctaatgtcatatcggcagctcgagctgccgcacaaataccggaatctgca
aaagctgttgtagtactatccccatattctttacagcatgtgttcccgagagaatgggta
acaaaatcgtataggaaaactatagtcgaacgaccagaaagattattagcaagctcgatg
ggtatatcagctgcgattacaatgtatccatcccttttcaccttgaaatcctcgcatcaa
aggaaaggttcattgatggcacctcatgtgcttaaagttcatggcagtagctggccggct
gagttaattgaactttgccaaatggcagatgctaaattgctaaaaggcgaaatcgaagtc
ccagatacttggaactcaggtgatatatacttgagctcaaagacaattaaagctctacag
ggaacaattggggccattgaaactggtgttgactcaattttcaaaggaccatctgcagaa
catattagtaacagagcttttgttgctatacggcctcctggtcatcattgccactatggt
acaccatccggcttttgtctgttaaacaatgcacatgtagccatagaatatgcgtatgat
acttacaacgtcacgcatgttgtcgtgcttgatttcgatctacaccacggtgatgggacc
caagacatttgctggaaacgtgcgggtttcaaacctgaggaggaacctgaagattcatct
tatgatgattttggtaagaaatttgccgaatttcccaaagtcggttatttttctatgcat
gatataaattcatttccaacagagtcgggatttgccacaaaggagaacattaaaaatgca
tctacctgtatcatgaactctcatgacctaaacatctggaatattcacttatccaaatgg
acaaccgaagaagaattcaatgtattatacaggacaaaatatagaactttatttgctaaa
gcagatgaatttttcaggagcgcaaaactagaaatgaatcaacaagggagaccattcaaa
ggtttggttgtcataagcgcaggtttcgatgcatcagaatttgagcaaacttcaatgcaa
aggcatagtgtcaacgttcctacaagtttttatacaacgttcaccaaagatgcattgaaa
ttagcacaaatgcactgtcatggcaaagttttgtctctaatggagggtggatattctgat
aaagctatatgttctggtgttttcgcacatttgatcggtttacaaaaccaagattgggtt
aaagaatgggggtctgaacaagtcgttaaagagattgttcgtggttgcaaaccggcttgg
aaaccctataagacaaaaagagcaaaagatgtcataagaatatgggcagaagaagttatc
aggctgggacgagcaatgataccggaattcgatgatatcatttttaaagacgcagttaac
agcgcaccttctaattctctactaaaggctactgtcgaaccagcatccacgtcgacaatt
gctcaaagaataatcagatctcatagaagcaacgcttccccagaaaaagaacttcatgaa
aacaagccgagaagcacggaaaaacaggaacaaagggaaattagaagcgataccaaggtc
aagcagctctcgtcaaataatagagcagctgaaacccaaattccgtttttgcaacaagaa
ttttccagtgaggatgaagatgaagaatacgtttacgatgaagaattgaacaaaactttc
aatcgcacggtggaggatattaccattgatgatatttctagacatttggagaccttagaa
attgaaaaaaaaggtgatgaagattcagaccatgagctaaaagaaaaaaattggaaaaac
tcgcaccaacgccgtctacaaggtaatggaatgtataaaattccctccaatacgaaaccg
catcgcataagacagcctcaaaacgcaaatacaccaacttatgacgatagtgatatatca
atgatttctcatgtttcaagaaaacatacaacaagaagtggtggaagatggtga

DBGET integrated database retrieval system