KEGG   Saccharomyces cerevisiae (budding yeast): YPR007C
Entry
YPR007C           CDS       T00005                                 

Gene name
REC8, SPO69
Definition
(RefSeq) Rec8p
  KO
K12780  meiotic recombination protein REC8, fungi type
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YPR007C (REC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YPR007C (REC8)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Meiosis-specific sister chromatid cohesion proteins
   Cohesin complex
    YPR007C (REC8)
SSDB
Motif
Pfam: Rad21_Rec8_N Rad21_Rec8
Other DBs
NCBI-GeneID: 856115
NCBI-ProteinID: NP_015332
SGD: S000006211
UniProt: Q12188
LinkDB
Position
XVI:complement(569336..571378)
AA seq 680 aa
MAPLSLNFKDDKKYKGLTTVWLLSALGNSIVKESNNYYSNKSNSTGNISSSTVKKKDIVN
ISIPKTCDEIQNFENDFSLRYISNLLYGVTICYNKKTEYVLNDLNHLLVQLQKNDVYAFK
AKNKSTRINGLNSNNSIIGNKNNNYTWEECVFFDDDPLYDITKVPALEFLNTTLQDNVSF
IEEAKSIRRQDYINELSNSNRFELHGDMTNSDAQSNLGSNVRNSFPLDEIPVDVDFNLDL
DDIVSHQGTPLGSHSSSQKDGNDFKFNYQGDELVLNFENDNENNSNGGEDTSVENEGPVA
NLKDYELGLEAQASEEENDLQQKLNTRMQRGHRADVGGQFSKVQFDAKTSYPNEVLKFNH
GNYSHLMEKNRIRKLTGQNFLTSNISSLVRSCGEEEFFSTNWLSIFNDFSNIKTSEWDLY
PQGFSSVERGRKRAHSLVSTQSSSSTRSHEYGRKSFRNNKNDNYSSDMENDNLLLNLEQI
NEDLEDGHYIEENSQGNILDFNLNLPPSSFGRSHTRNSTRSSGFNEDIVGALRRRVGPSE
QNFAEEDDSSNSCFSDGSQQNLQQDKTNFQDVILDYQTKKFYDYIKERSIVVGRTTRSNP
PFKRKMLLVDIIPSRMGEAQTGANFDDVERGVSRQIAASAFLSLLNLATKGMVKLNEYPV
ADAVTKDLKLRREDEIIVYA
NT seq 2043 nt   +upstreamnt  +downstreamnt
atggcacctctttcgttgaactttaaagatgacaagaaatataagggcctcacaacagtg
tggttgctttctgcgttgggaaattccattgtaaaggaaagtaacaattattattcaaac
aaaagcaactccactggaaacatatcttcatccaccgttaagaaaaaagacatcgtaaat
atttccataccaaaaacatgtgatgaaattcaaaatttcgaaaatgatttttctcttaga
tacatttctaatcttttatatggagtgacaatttgctataataaaaaaaccgagtatgtg
ttgaatgacctaaatcacctgcttgtgcagttacaaaaaaatgatgtatacgcttttaag
gccaaaaataagtctacgaggattaatggattgaatagtaataacagtattataggaaac
aaaaacaataattacacctgggaagaatgcgtttttttcgatgacgatcccttatatgat
attactaaagttcccgcactggagtttcttaacactactctccaagataatgtatctttt
attgaggaagctaaatcaataaggagacaagactacatcaatgagttaagtaattctaac
aggttcgagcttcatggggacatgactaactcagacgcgcaaagtaatctaggatctaac
gttagaaattcttttccgctggatgaaattcccgttgatgtggactttaacctggactta
gatgatatagtgagccatcaggggacacctttaggctctcactcaagttcacagaaggat
ggaaacgatttcaagtttaattatcaaggagatgaattggtgttgaattttgagaacgat
aatgaaaataacagtaatggaggagaagatacatcagttgaaaatgaagggccggtagcc
aatctcaaagactacgaattggggttagaagcgcaggcttctgaagaagaaaacgatctt
caacagaaacttaacaccagaatgcaaagaggacatcgcgccgatgtaggtgggcaattt
tctaaggtacaatttgatgccaaaacgagttatccaaatgaagttctcaaattcaaccat
ggaaattacagtcacttaatggaaaaaaacaggattagaaaactaaccggccaaaatttt
ctcacctctaacataagtagtttggtaaggtcatgtggtgaggaagaatttttttcaaca
aattggttaagtatatttaacgacttttccaatataaagactagcgaatgggacttatat
ccccaaggttttagttcagttgaaagagggagaaaaagagcacattctttagtatcaacc
caaagctcaagtagtaccagaagtcacgaatatggtaggaaaagttttcgcaataataag
aacgataattattcttccgatatggaaaatgataatttacttttaaaccttgaacaaatt
aatgaggatttggaagatgggcactatattgaagaaaactctcaaggtaacatcctagat
tttaatttgaatctacctccttcaagttttggaagaagtcataccagaaactcaaccagg
tctagtggtttcaatgaagatatagttggtgctctcagaaggagagtcgggccatctgaa
cagaattttgccgaggaagacgattccagcaacagttgtttttctgatggctctcagcaa
aatttgcagcaggacaaaacaaattttcaagacgtcattctggattatcaaactaaaaaa
ttctacgattacatcaaagaaagatcaattgttgtcggaagaacaacgcgctccaatccg
cctttcaagagaaagatgctgttggttgacatcatcccaagccgcatgggcgaagctcaa
acgggagctaactttgatgatgtagaaagaggtgtcagcagacagatagccgccagtgcc
ttcctatccttactgaatttggctacgaaagggatggtcaagttgaacgaatatcctgtt
gcagatgcggtaactaaagatcttaaactgagaagagaggacgaaataattgtatatgcc
tga

DBGET integrated database retrieval system