KEGG   Streptococcus parasanguinis FW213: Spaf_0229Help
Entry
Spaf_0229         CDS       T02115                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
scf  Streptococcus parasanguinis FW213
Brite
KEGG Orthology (KO) [BR:scf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scf01001]
    Spaf_0229
Enzymes [BR:scf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Spaf_0229
Protein kinases [BR:scf01001]
 Serine/threonine kinases: Other
  Bacterial family
   Spaf_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kdo Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AFJ25253
UniProt: I1ZJM9
LinkDB All DBs
Position
233106..234974
Genome map
AA seq 622 aa AA seqDB search
MIQIGKIFAGRYKIIQQIGRGGMADVYLARDLILDGEEVAVKVLRTNYQTDPIAVARFQR
EAKAMAELDHPNIVRITDIGEEEGQQYLAMEYVAGLDLKRYIKENAPLSNEEAVRLMGQI
LLAMRLAHTRGIIHRDLKPQNVLLTPDGTAKVSDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSIREENKNVP
QALENVVIKATAKKLTDRYKSVAEMYVDLSSCLSYERRNEKKLVFEDQTKADTKTLPKVS
PTPKTAPVPISEVRSEISSVDPKRPLSNQQVVAPNKKPRRRLRARYKVLFVAIALVLAAF
TFLLYMSPANKTVPDVSGKTIAEARAIIEGQDLQVGEEKEEYSDTVAEGYVIRTNPNAGA
QKREQSRIDLIVSKGPNSFEMPNYVGETRAKAEDDLKNTYKVSSKMISIEEVETFDYDPG
TVIEQTPAAGEQYSLNSKTKIVLKVAKETTSIEMPNYIGSTYDFARSNLIEIYDIKEANI
ELRKTDHLPDGVVVSAGQIVSQTPEASNTVDINRTRIILTVYEPKVTSSSSTKASSSSET
SSSSSSDRKDTDSSSSSAADDD
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatcggcaaaatttttgccgggcgatataaaatcatccaacaaattgggcgc
ggcgggatggcagatgtttatcttgcgcgtgatttgattttagatggtgaagaagttgca
gtcaaggtactgcgtacgaattatcagacggatcccattgcagttgctcgttttcagcgg
gaagcaaaagcgatggcggaactggaccatccaaatatcgttcggattacagacattggc
gaagaagaagggcaacaataccttgcaatggaatatgttgcaggtttagacttgaaacgc
tatatcaaagaaaatgcacctttatcaaatgaagaagcggttcgtttgatgggacagatt
ctccttgctatgcgtctagcccatacgcgtggcattatccatagagatttaaaaccacag
aatgtcctcttgactccggatgggactgcaaaagtttcagactttgggattgcagtggcc
tttgcagagacaagcttgacccagaccaactctatgttaggatcagtccattatttgtca
cctgagcaggcacggggatcgaaagctacggttcaaagtgacatttacgctatgggaatt
attttctatgagatgttgactggacacattccttatgatggggatagtgcggttacgatt
gcactgcaacatttccaaaaacctcttccctctattcgtgaagaaaataagaatgttccg
caagctttagaaaatgttgtgatcaaagcgacggctaagaagctgacggaccgttataag
tcagtagcagagatgtatgtagatctttcaagctgcctgtcttatgagaggagaaatgag
aaaaagctggtttttgaagatcaaacaaaggctgatacaaaaactcttccgaaagtgagt
ccgactccaaagaccgctccagttccaatctctgaggtgcgcagtgaaatcagttcggtg
gatccaaaacggccattatccaaccagcaggtcgtggcaccaaataaaaagccaagaaga
cgcttacgtgcacgttataaagtattgtttgttgcaatcgcgctagttcttgctgccttt
accttcttgttgtatatgagtccagccaataaaacagttccggatgtttctggtaagact
attgctgaggccagagcgattatcgaaggtcaagatcttcaagttggtgaagaaaaggaa
gaatatagtgatactgttgcggaaggctatgtcattcgaactaatccaaatgcgggagct
caaaagagggaacaaagtcgaattgatttgattgtttcaaagggaccaaatagctttgaa
atgccaaattatgtaggagaaacgagggcaaaagcagaggatgatctgaaaaatacttat
aaagtgtcaagtaagatgatcagtatagaggaagttgaaacttttgactatgatcctggg
acggttattgagcaaacaccggcagcaggtgagcaatattctttgaattcaaaaactaag
attgtattaaaagtagcaaaagaaacaacttcaattgaaatgccaaactatattggatca
acctatgatttcgcacgtagcaatttgattgaaatatatgacatcaaggaagccaatatt
gaattaagaaaaacggaccatcttcctgatggggttgttgtttctgcagggcaaattgtg
agtcaaactcctgaggcatctaatacagtggatattaatcggaccagaattatattgaca
gtgtatgagcctaaagtgacttcttcttcaagtacgaaagcttcttcaagttcagaaacg
tctagttcgtcttcatcagatcgaaaggataccgatagttcaagtagtagtgcagcagat
gatgattag

DBGET integrated database retrieval system