KEGG   Streptococcus parasanguinis FW213: Spaf_0708Help
Entry
Spaf_0708         CDS       T02115                                 

Gene name
sodA
Definition
(GenBank) manganese-dependent superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
scf  Streptococcus parasanguinis FW213
Brite
Enzymes [BR:scf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Spaf_0708 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFJ25714
UniProt: I1ZKZ0
LinkDB All DBs
Position
724155..724760
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPYIDEETMHLHHDKHHQTYVNNVNAALEKHPEIGEDLESLLADV
ESIPADIRQAVINNGGGHLNHALFWELMTPEQTAPSAELAAAIDATFGSFEDFKAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPLSEGKTPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVNELFVAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctatcattttaccagaattaccatatgcttatgatgcattggaaccttatatcgat
gaagaaaccatgcatttgcaccatgataaacaccatcaaacatatgtaaacaatgttaat
gcagctcttgaaaaacatcctgaaattggagaagaccttgaaagcttgttagctgatgtt
gaatccattccagctgacattcgccaagctgtaatcaacaatggtggtggtcatttgaac
catgctcttttctgggaattgatgactccagaacaaacagctccttcagcagaacttgct
gcagcgattgatgctacatttggttcatttgaagacttcaaagcagccttcacagcagca
gcaacgacacgttttggttctggctgggcatggttggttgtcaacaaagaaggcaaactc
gaagtgacttcaacagcaaaccaagatacaccactctctgaaggtaaaacaccaatcctt
ggtttggatgtctgggaacacgcttactacgtgaaataccgtaacgtacgtcctgactac
atcaaagctttcttctcagtgatcaactggaataaagttaatgaattgtttgtagcagca
aaataa

DBGET integrated database retrieval system