KEGG   Streptococcus parasanguinis FW213: Spaf_1029Help
Entry
Spaf_1029         CDS       T02115                                 

Definition
(GenBank) Thymidine kinase, putative
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00240  Pyrimidine metabolism
scf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Spaf_1029
Enzymes [BR:scf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Spaf_1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_14 AAA_30 AAA_22 ATPase_2 SRP54
Motif
Other DBs
NCBI-ProteinID: AFJ26021
UniProt: I1ZLU7
LinkDB All DBs
Position
1040544..1041131
Genome map
AA seq 195 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKSVVIMTSAIDTRDGVGVVSSRIGMKREAV
AIEDDTDIFGFIKNQAIKPYCVLIDEAQFLKRHHVYDLARVVDELDVPVMAFGLKNDFRN
ELFEGSKHLLLLADKIEEIKTICQYCSRKATMVLRTQAGKPVYDGEQIQIGGHETYISVC
RKHYFNPDINQEKKS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattatattataaatatgggaccatgaactcggggaaaaccattgagattttg
aaggtggcccataattatgaagagcaaggcaagagcgtcgtcatcatgacctcagcaatc
gatacacgagatggagtaggagtggtttctagccggatcggtatgaaacgcgaagccgtt
gcgattgaagacgatacggatatctttggctttattaaaaaccaagcaatcaaaccctac
tgtgtcttgatcgatgaagctcagtttttgaaacgtcaccatgtctatgacttggcaaga
gtcgtggatgaactggatgtgccggttatggcttttggcctcaaaaatgatttccgaaat
gaactctttgaaggttccaaacatctcctcttgttagccgacaagatcgaggagatcaaa
accatctgccaatactgttcccgcaaggcaaccatggtcttgcgtacccaagcgggtaaa
cctgtctatgatggagagcagatccagatcggtggacacgagacctatatctccgtttgc
cgcaagcattattttaatccagatattaaccaagaaaagaaatcttaa

DBGET integrated database retrieval system