KEGG   Streptococcus parasanguinis FW213: Spaf_1440Help
Entry
Spaf_1440         CDS       T02115                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, putative
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00620  Pyruvate metabolism
scf00680  Methane metabolism
scf01100  Metabolic pathways
scf01120  Microbial metabolism in diverse environments
scf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spaf_1440
  09102 Energy metabolism
   00680 Methane metabolism
    Spaf_1440
Enzymes [BR:scf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Spaf_1440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFJ26413
UniProt: I1ZMY9
LinkDB All DBs
Position
complement(1455507..1458332)
Genome map
AA seq 941 aa AA seqDB search
MVLQKLENFRNKDIVKEEAEILTDLLDDITKNLVCPETFEKISQLKDLSKTKNYRDLNQL
VEQLSNEEMTVISRYFAILPLLINISEDVDLAYEINHLNNVDGDYLGKLSSTIKEVAKNE
DAQEILENLNIVPVLTAHPTQVQRKTMLDLTNHIHALLRQHRDVKAGLINENKWYNNLRC
NIEIMMQTDMIRDKKLKVTNEITNVMEYYNSSFLQAVPNLVLEYKRLAKEHGLELEQPHP
ITMGMWIGGDRDGNPFVTADTLKRSATIQSEVILNYYIEKISKLYRHFSLSTSLSNTSEA
VAEMAALSSDTSVFREKEPYRRAFHYIQSKLIQTLVNLKEWTMVGETREDRYAVERLLGA
SNHQQGPVSDYIGNRISGALKEISAKESPAYASAQEFKEDLEKIKDSLLENKSEYLISGE
FAELLEAIDVFGFYLASIDMRQDSSVHEACVAELLKSAGINDHYSDLSEDEKCQILLKEL
LEDPRILSATHADKSELLEKELAIFQTARELKDRLGEEVIRQNIISHATSVSDMLELAVM
LKEVGLIDTEKARVQIVPLFETIEDLDHSEETMRSYLSLPIAKRWIASKNNYQEIMLGYS
DSNKDGGYLSSCWTLFKAQQQLTAIGDEFGVKITFFHGRGGTVGRGGGPTYEAITSQPLK
SINDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSATINRMIAEQKSPFSMFDRFGEVMDK
VVNRSYDIYRDLVFGNEHFYDYFFESSPIKAISSFNIGSRPAARKTITEIGGLRAIPWVF
SWSQSRVMFPGWYGVGSSFKEFIDEDPENIETLRYMYKNWPFFQSLLSNVDMVLSKANMD
IAFEYAQLCEEEEVRNIYQIILHEWQLTKDIILMIEEQEELLAENSYLKESLDYRMPYFN
VLNYIQLELIRRQRTGQLPADQDKLIHITINGVATGLRNSG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggtcttacaaaaattagagaactttagaaataaagacattgtcaaagaagaagccgaa
attctaacagatctattagatgatattactaaaaatcttgtttgtccggagacatttgaa
aaaatttcacaattaaaggatctatcgaaaacaaagaattaccgtgacttgaaccaatta
gtagaacaattgtctaatgaagaaatgacggtaatctcacgctattttgcgattttacca
ctgttgatcaacatctctgaagatgtcgatttagcttatgaaatcaatcatcttaataat
gtggatggcgattatcttgggaaactttcttcaacgattaaagaagttgcaaaaaatgaa
gatgcacaagaaattttagaaaatctaaatattgtacccgttttaacggcccatccgact
caagtgcaaagaaagaccatgctggatttgaccaatcatattcatgctttacttcgccaa
catcgggatgttaaagcaggattgatcaatgagaataagtggtataataaccttcgttgt
aatattgaaatcatgatgcaaacggatatgatccgtgataaaaaattgaaggtgacaaat
gagatcaccaacgtcatggagtattacaatagttccttcttacaagctgttccaaacctc
gtgttggaatacaaacgtttagcaaaagaacatggtttagagctcgaacaaccacatcca
attacaatgggaatgtggattggaggagacagggatggaaatccttttgtgacggctgat
actttaaaacgttcagcaaccattcaaagtgaagtcattttgaactattacattgaaaag
atttctaaattataccgtcatttctcactttcaactagtctctctaatactagtgaagcg
gtagctgagatggctgccttgtcaagtgatacgtcagtctttcgcgaaaaagaaccttac
cgtcgtgctttccactatatccaatcaaaattgatccaaaccttggttaacttaaaagaa
tggactatggttggtgaaacaagggaagaccgctatgcggtagagagattattgggagca
agtaatcaccaacaagggcccgtttctgattatattggtaatcggatttcaggcgcctta
aaagagatttctgctaaagaatctccagcttatgcgtccgctcaagagtttaaagaagat
cttgaaaagattaaagattccttgttagaaaataaatcagagtatttgatttccggtgag
tttgcagaactcctagaagctatcgatgtctttggtttttaccttgcatctattgatatg
cgccaagattctagtgtgcatgaagcctgtgtggcagaattgctgaaatcagcagggatt
aatgatcattattcagatttatcagaggacgaaaagtgtcagattctcttgaaagaactc
ttagaagacccacgtattttatcagcaacccatgccgataaatctgagttgcttgaaaaa
gaattggcgattttccagacagcgcgtgaattgaaggatcgcttgggtgaagaagttatc
cgtcaaaacattatctcccatgcaacaagcgtatcagatatgttggaactggcagtgatg
ttaaaagaagtgggcttaattgatactgaaaaagcacgtgtgcaaattgttccattgttt
gaaacaattgaagatttggatcattcagaagaaactatgagaagctacttgtcacttcca
atcgctaaacgttggattgcttctaagaataattaccaagaaattatgttaggttactct
gattccaataaagatggtggttatttgtcttcttgttggaccctctttaaagctcaacaa
caattgactgcaattggagatgagtttggagtgaagatcactttcttccatggccgtggt
ggtaccgttggccgtggtggaggtcctacttatgaagccatcacgtctcaaccattgaaa
tcgattaatgaccgaattcgcttaactgagcaaggggaagtaatcggaaataaatatgga
aataaagatgccgcttattacaaccttgagatgctcgtctctgcaaccattaaccgaatg
attgccgaacaaaagagtccattctctatgttcgatcgtttcggggaagtcatggataaa
gtcgtgaatcgtagttacgatatctatcgtgatttggtctttggaaatgagcacttctat
gactacttctttgaatcaagtccgatcaaggctatttctagctttaatattggttcgcgt
ccagctgctcgtaagaccattacagaaattggtggtttacgtgcgattccttgggtattc
tcctggtcacaaagtcgtgtgatgttccctggttggtacggagtaggttctagctttaag
gaatttatcgatgaggatcctgagaatatcgaaacccttcgatacatgtataaaaactgg
cctttcttccaatctctcttgtcaaatgtggacatggtcttatcaaaagccaatatggat
attgcctttgagtacgcgcaattgtgtgaagaagaagaagtgcgcaatatttatcaaatt
atcttacatgaatggcaattgacgaaggatatcatcttgatgattgaggaacaagaagaa
ttactcgcggaaaactcttatttgaaagaaagtttggactatcggatgccatactttaac
gtcttgaactatattcagttagaattgattcgacgtcaacggaccggccaattaccagcc
gatcaagacaagctgatccatattactatcaatggagtggctacaggattacgaaattca
ggctaa

DBGET integrated database retrieval system