KEGG   Streptococcus parasanguinis FW213: Spaf_1661Help
Entry
Spaf_1661         CDS       T02115                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00220  Arginine biosynthesis
scf00250  Alanine, aspartate and glutamate metabolism
scf00290  Valine, leucine and isoleucine biosynthesis
scf01100  Metabolic pathways
scf01110  Biosynthesis of secondary metabolites
scf01130  Biosynthesis of antibiotics
scf01210  2-Oxocarboxylic acid metabolism
scf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spaf_1661
   00290 Valine, leucine and isoleucine biosynthesis
    Spaf_1661
   00220 Arginine biosynthesis
    Spaf_1661
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:scf01007]
    Spaf_1661
Enzymes [BR:scf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Spaf_1661
    2.6.1.66  valine---pyruvate transaminase
     Spaf_1661
Amino acid related enzymes [BR:scf01007]
 Aminotransferase (transaminase)
  Class I
   Spaf_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Alliinase_C Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFJ26622
UniProt: I1ZNJ8
LinkDB All DBs
Position
complement(1675929..1677143)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKIPNVDINDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEEANWYPDIEDIKSKITSNTKAIVVINPNNP
TGALYPDEILLEIVEIARQNNLIIFADEIYDRLVMDGEKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKHHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINDIPGLSAVKPKAGLYIFPKIDRDMYRVDDDEQFVLEFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLKQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaatataataaatcaagcaaactcgaacatgtcgcttacgatattcgtggtcca
gtcttggaagaagcgatgcgcatgcgagcaaatggagaaaagattcttcgtttgaataca
ggaaatcctgctgaatttggctttacagctccagatgaagtcatccatgatttgatcatg
aatgcgcgtgatagtgaaggttattcggattcaaaagggatcttttcagcccgtaaggcc
atcatgcaatattgtcagttgaagaaaattccaaatgtcgatatcaatgatatttacctt
ggaaatggggtgagtgagctgatcgtcatgtccatgcaagggcttttggacaatggggat
gaagtattggtaccaatgccagactatcctctttggacggcggcagtcagcctagctggt
gggaacgcggttcactatctttgtgacgaagaagcaaactggtatccagatatcgaggat
atcaagtcgaaaatcacttcaaacaccaaggctatcgttgtcatcaacccgaataaccca
acaggtgccctctatccagatgagatcctgcttgagattgtagagatcgctcgtcaaaat
aacttgatcatctttgcggatgaaatttacgatcgtttggtcatggatggtgaaaaacat
acggctatcgcaagtttagcgcctgatctcttctgtgtgagtatgaatggcttgtcaaaa
tctcaccggattgccggtttccgtgttggttggatggttctatccggaccgaaacatcat
gtgaagggttatatcgaaggtttgaacatgttgtccaatatgcgtctttgttcgaatgtc
ttggctcaacaagttgtgcaaacctctcttggaggttaccaatccgtggatgaactttta
cttccaggtggtcgaatctacgaacaacgcaacttcatctacaaagctatcaatgatatt
ccaggcctctcagctgttaagccaaaggctggtctctatatcttccctaagattgatcgg
gacatgtaccgcgtggatgatgatgaacaatttgttttagagttcttgaagcaagaaaaa
attctcttggttcatggccgtggctttaactggaaagacccagatcacttccggatcgtt
taccttccacgtgtggatgaattggctcaaattcaagaaaaaatgactcgtttcttgaaa
caatacaaacgctaa

DBGET integrated database retrieval system