KEGG   Streptococcus constellatus subsp. pharyngis C1050: SCI_0275Help
Entry
SCI_0275          CDS       T02832                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
scg  Streptococcus constellatus subsp. pharyngis C1050
Pathway
scg00010  Glycolysis / Gluconeogenesis
scg00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:scg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCI_0275
   00500 Starch and sucrose metabolism
    SCI_0275
Enzymes [BR:scg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SCI_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF3226
Motif
Other DBs
NCBI-ProteinID: AGU79257
LinkDB All DBs
Position
263709..265148
Genome map
AA seq 479 aa AA seqDB search
MSKFPADFLWGGATAANQYEGAYNLDGKGLSVQDVTPKGGIPANAGDLNPLITDKPTADN
LKLEGIDFYHRYKEDIALFAEMGFKVYRTSIAWSRIFPNGDETEPNEAGLKFYDDLFDEL
AKYNIEPLVTLSHYETPLHLARQYNGWANRDLIGFYERYVRTVFTRYKDKVNYWLTFNEI
NSVLHAPFMSGGIATPVEELSKQDLYQAVHHELVASALATKIGHEINPDFKIGCMVLAMP
TYPMTPKPEDVLAAREFENQNYLFSDIHARGKYPAYMNRFFKENGIKIQFAPGDKELMSE
HTVDFVSFSYYMSVVAAHDPESYSSGRGNVLGGLQNPYLTASEWGWQVDPIGLRLVLNAF
YDRYQLPLFIVENGLGAKDVLVDGPDGPTVEDDYRIDYLKRHLQQVGEAIEDGVELWGYT
TWGCIDLVSASTAQMSKRYGFIYVDRNDDGTGTLARYKKKSFDWYKEVIATNGGKLYED
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatttccagcagattttctttggggtggtgcaacagctgctaatcaatatgaa
ggtgcttataatttggatggtaaaggtctttcggttcaagatgtgacgccaaaaggtggc
ataccagctaatgcaggtgatctcaatcctttgattacagataagccaacagctgataac
ctaaaattggaaggaattgacttttatcatcgttacaaagaagatattgccctttttgca
gaaatgggcttcaaggtttatcgtacttctattgcttggtcacggattttcccaaatggt
gatgaaacggagccaaatgaagcaggtctaaagttttatgacgacctttttgatgaattg
gccaaatataacattgaacctttggtgactttgtcacattatgaaacacctttgcatttg
gcgcgtcagtataatggttgggcaaatcgtgatttgattggcttttatgagcgctatgtt
cgtaccgtctttactcgttacaaagacaaggtgaactattggttgacctttaatgaaatc
aactctgttttacatgcgccgtttatgagtggagggattgcaactccagtagaagaattg
tccaaacaagatctttatcaagccgttcatcacgaactagtggcatcagctcttgcaact
aaaattgggcatgaaatcaatccagattttaagattgggtgtatggtgctagctatgccg
acttatccgatgacgccaaaaccagaggatgtactggctgcccgtgagtttgaaaatcag
aattatctcttttcagatattcatgcgcgtggtaaatatccagcatatatgaaccgtttt
ttcaaggaaaatggaatcaagatccaatttgcaccgggtgataaagaattgatgtcagag
cataccgtagatttcgtctccttctcttattacatgagtgtggttgctgcccatgatccg
gaaagttattcttctggtcgtggaaatgtgctgggtgggttgcaaaatccttatctaact
gcttcagaatggggctggcaagtggatccaattggtctgcgtctggttctcaatgctttc
tatgaccgttaccagttaccgctctttatcgtagaaaatggtcttggtgcgaaagatgtc
ttggtagatggtcctgatggtccgactgttgaagatgattatcgcattgattatcttaaa
cggcatttacagcaggtcggcgaagcaattgaagatggtgttgaactctggggctacacc
acttggggctgtattgaccttgtgtctgcttcaacagctcagatgagcaagcggtacgga
tttatctatgttgatcgaaacgatgatggaacagggactttggctcgctataagaagaaa
tcatttgattggtataaagaagttattgcaacgaatggaggaaaactctatgaagattga

DBGET integrated database retrieval system