KEGG   Streptococcus constellatus subsp. pharyngis C1050: SCI_0872Help
Entry
SCI_0872          CDS       T02832                                 

Definition
(GenBank) putative ribonuclease BN
  KO
K07058  membrane protein
Organism
scg  Streptococcus constellatus subsp. pharyngis C1050
Brite
KEGG Orthology (KO) [BR:scg00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SCI_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Herp-Cyclin
Motif
Other DBs
NCBI-ProteinID: AGU79817
LinkDB All DBs
Position
893613..894515
Genome map
AA seq 300 aa AA seqDB search
MKKLVSRIGHNPFLQAFFKFYQASEIDLTSIAVAYYLLISIFPLLLIVVNILPYFQIPIA
EFLEAIEDVLPESLYEVIAKVIRNVLTQPSSGLLSFSILSALWAFSQSMSFLQKAFNKAY
GVAKDRGLISHRLFSIVMSLGLQLLFALSLLLTMFGRMSLRLLHSFWGFDNQLYTSLQKM
TQPTIYTLLFLSLLMLYYFLPNVKIKKIRYVLPGTVFVVLTIGVLLNLFSVYLDTYVNHL
MDVRFFSSIFVVVVMIWFTLIAQILIIGAILNASYQSCHESSFETRHKQLTTRLIQKTKK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttggtttctaggatcggacataatccatttttacaagctttttttaaattt
tatcaggcatctgagattgatttgaccagcattgcagtggcttattatttgttgatttca
atttttccattgctgttaattgttgtgaatatattgccttattttcaaattccaatagca
gaatttttagaagcgatagaagatgttctgccagagtcactttatgaagtgattgcaaag
gtcattcgtaatgtattaacccaaccgtcttctggattgttgagcttctccattctttcg
gctttatgggctttttcacaatcaatgtctttcttgcaaaaagcttttaataaagcttat
ggtgtcgccaaagatagaggactcatttcgcacagattgtttagtatagtgatgagttta
ggattacagttgctctttgctctttctcttttgctgacaatgtttgggcgaatgtctctt
cgtctgctccatagtttttggggatttgataaccagctttatactagtctacaaaagatg
acgcagccaaccatttacactttactttttctttctttattgatgttgtattacttttta
cctaatgtcaaaatcaagaaaattcgctatgtactaccaggaacggtttttgtagttctt
acaattggtgtattgctaaatttgttttccgtttatttggacacttatgtaaatcactta
atggatgttcgatttttcagttccatttttgttgtggtagtgatgatttggtttactctc
attgctcaaatacttattattggcgcgattctaaatgcaagttatcaaagttgtcacgaa
agttcatttgaaacaaggcataaacaattgactacgcgactcattcaaaaaacaaaaaaa
tga

DBGET integrated database retrieval system