KEGG   Streptococcus constellatus subsp. pharyngis C1050: SCI_1576Help
Entry
SCI_1576          CDS       T02832                                 

Gene name
aspC
Definition
(GenBank) putative aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
scg  Streptococcus constellatus subsp. pharyngis C1050
Pathway
scg00220  Arginine biosynthesis
scg00250  Alanine, aspartate and glutamate metabolism
scg00290  Valine, leucine and isoleucine biosynthesis
scg01100  Metabolic pathways
scg01110  Biosynthesis of secondary metabolites
scg01130  Biosynthesis of antibiotics
scg01210  2-Oxocarboxylic acid metabolism
scg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCI_1576 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    SCI_1576 (aspC)
   00220 Arginine biosynthesis
    SCI_1576 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:scg01007]
    SCI_1576 (aspC)
Enzymes [BR:scg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SCI_1576 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     SCI_1576 (aspC)
Amino acid related enzymes [BR:scg01007]
 Aminotransferase (transaminase)
  Class I
   SCI_1576 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 MHC_II_alpha Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGU80477
LinkDB All DBs
Position
complement(1609263..1610477)
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSTKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKNIPNVDIEDVYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEQADWYPDIEDIKSKITSNTKAIVVINPNNP
TGALYPKEVLEYLVEIARQNNLIIFADEIYDRLVMDGEKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKSHVKDYIEGLNMLSNMRLCSNVLSQHVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINEIPGLSATKPKAGLYIFPKIDREMYQVDDDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaataaatcgacaaagttagaacatgtagcttatgatattcgtggtcca
gtcctagaagaagccatgcgaatgcgtgcaaatggtgagaagatcctccgtttgaataca
ggaaatcctgccgaatttggttttacggcaccagatgaagtgattcatgatttgattatg
aatgcacgggatagcgagggctattcagactcgaaaggaattttttctgctcggaaagcc
attatgcagtattgtcagttgaagaatattccaaatgtcgatattgaggacgtttatctt
ggtaatggggttagcgagctgattgttatgtcaatgcagggcttgctggataatggggac
gaagttctagtgccaatgcctgattatccgctctggacagctgctgttagcttagcagga
ggcaatgcggttcattatctttgtgatgagcaggcggattggtatccagatatagaagat
atcaaatcaaagattacttctaatacaaaggctattgtcgttatcaatccaaacaatccg
accggtgccttgtaccctaaggaagtcctagaatatcttgttgaaattgcacgacaaaat
aacttgattatttttgcggatgagatttatgaccgtttagtgatggatggtgagaaacat
acagcgattgctagtctggcaccggatcttttctgcgtcagcatgaacggtttgtctaaa
tcgcaccgtatcgcaggttttcgcgtaggctggatggtgctttcaggtccaaaatctcat
gtgaaagattatatcgaaggactgaatatgctgtcaaatatgcgtttgtgctcaaacgtc
ttatctcagcatgtggtccaaacatctcttggaggttatcagtcagtagacgaattgtta
cttcctggtggtcgcatttatgagcaacggaattttatttacaaggctatcaatgaaatt
ccaggtttgtctgcgaccaaacctaaagcaggactgtatatttttccaaaaattgataga
gaaatgtatcaagtggatgatgacgaacaattcgtgctggatttcttaaagcaagaaaag
attttgctggtgcacggacgcggatttaattggaaagacccagatcatttccgtatcgtt
tatctgccacgtgtagatgaattagcacagatccaagaaaagatgacgcgtttcttaagg
caatatcgaagataa

DBGET integrated database retrieval system