KEGG   Sphingobium chlorophenolicum: Sphch_0575Help
Entry
Sphch_0575        CDS       T01522                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00970  Aminoacyl-tRNA biosynthesis
sch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sch00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sphch_0575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sch03029]
    Sphch_0575
Enzymes [BR:sch01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Sphch_0575
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Sphch_0575
Mitochondrial biogenesis [BR:sch03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Sphch_0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Phasin
Motif
Other DBs
NCBI-ProteinID: AEG48270
UniProt: F6EXY8
LinkDB All DBs
Position
1:601911..603413
Genome map
AA seq 500 aa AA seqDB search
MTESTYRIQGATGEWEVVIGLEVHAQVTSEAKLFSGAATAFGAEPNTQVSLVDAAMPGML
PVPNRECIRQAVRTGMAIEAQINKWSRFDRKNYFYADLPQGYQISQLYHPLVGEGAIEIS
LDDKNPDAVTKRIGIERIHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSKPDMRSPA
EAGAYLSKLRTILRYVGSCDGNMDQGSMRADVNVSVRKPGEEFGTRTETKNVNSVRFVMA
VVEHEANRQVDVLEAGGKVVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELDD
AFLEECRQSLPELPDAKRRRYEQDLGLSAYNAATLTADADTARWFEALLAEGARIQKKSE
SEVAKASANWLLSELYGALNRLGKSLEDSPVGPEEGAELLALIADGTISGTIAKQVFEIM
LETGERAPKVVEEKGLKQTSDTGAIEAAVAKVLADNGDKVEQYKAGKEALFGFFVGQTMK
AMQGKANPQVVNELIRKALG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatcaacctatcgcattcagggcgcaaccggcgagtgggaggtcgtgatcggc
ctggaagtccatgcgcaggtgacgagcgaggcgaagctcttttccggcgcggccacggct
ttcggggcggagccgaacacgcaggtgtcgctggtcgacgcggccatgcccggcatgctg
cccgtgccgaaccgcgaatgcatccgccaggcggtgcgtaccggcatggcgatcgaggcg
cagatcaacaaatggtcgcgtttcgaccggaagaattatttctacgcggacttgccccag
ggttatcagatcagccagctttaccacccgctggtgggcgagggcgcgatcgagatcagc
ctggacgacaagaatcccgatgccgtgaccaagcggatcggcatcgagcgcatccatgtc
gagcaggacgcgggcaagctgatgcacgatcagcatccgacgcgatcctatgtcgacctc
aatcgctccggcgttgcgttgatggagatcgtgtcgaagcccgacatgcgctcgcccgcc
gaggccggggcctatctgtcgaagctgcggacgatcctgcgctatgtcgggtcgtgcgac
ggcaatatggatcaggggtcgatgcgcgccgatgtcaacgtctcggtccgcaagcccggc
gaggagttcggcacccgcaccgagacgaagaatgtgaattcggttcgtttcgtcatggcg
gtggtcgaacatgaagccaaccggcaggtcgacgtgctggaggcgggcggcaaggtggtg
caggaaacgcgcctctacgatccggacaggaatgaaacgcggtccatgcggtcgaaggaa
gacgcgcatgactatcgctatttccccgatccggacctgctgccgctggaactggacgat
gcgtttctggaggaatgccgccagtcgctacccgaattgccggacgccaagcgccggcgt
tatgagcaggatctgggccttagcgcctataacgccgccacgctgaccgccgacgcggac
accgcccgctggttcgaggcgctgctggccgagggcgcgcgcatccagaagaagagcgag
agcgaagtcgccaaggcttcggccaactggctgttgtcggagctttacggcgcgctcaat
cgtctgggcaagagtctggaggacagcccggtcgggccggaagagggcgcggaactgctg
gccctgatcgcggacgggacgatcagcggtaccatcgccaagcaggtgttcgagatcatg
ctcgaaaccggagaacgcgcgccgaaggtcgtcgaggaaaaggggctgaagcagaccagc
gacaccggcgctatcgaggcggcggtggccaaggtgctggccgacaatggcgacaaggtc
gagcagtataaggcgggcaaggaagcgctgttcggcttcttcgtcggccagacgatgaag
gcgatgcagggcaaggccaatccgcaggtcgtcaatgaactgatcaggaaggctttgggc
tga

DBGET integrated database retrieval system