KEGG   Sphingobium chlorophenolicum: Sphch_1250Help
Entry
Sphch_1250        CDS       T01522                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00240  Pyrimidine metabolism
sch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sch00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sphch_1250
Enzymes [BR:sch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Sphch_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AEG48939
UniProt: F6EW60
LinkDB All DBs
Position
1:complement(1353001..1353582)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSSFNYRERGMETMLWTAAIDDRYEQGLIVSRIGLEAKAH
LFDAATDLFAAISTQHARTPLSCILVDEAQFLDTAQVWQLAAVADRLAIPILCYGIRTDF
QGQLFEGSAALLGLADTLTEIKTICECGRKATMNLRVDGKGRPIREGEQTEIGGNDRYVA
LCRRHFVERRSGH
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttctactatagctcgatgaacgcagggaaatcgaccaccctgctg
caatccagcttcaactatcgcgagcgcggcatggaaaccatgctctggaccgccgccatc
gacgaccgctacgaacagggtctgatcgtctcgcgcattgggctggaggcaaaggcccat
ctgttcgacgccgcgacggaccttttcgccgccatttccacgcagcatgcccgaacgccg
ctgtcctgcatattggtcgacgaagcgcaattcctcgacacggcccaggtctggcagctt
gccgccgtggccgaccggctggccatccccatcctctgctacggcatccgcaccgatttt
caggggcagttgttcgagggcagcgccgcgctcttgggtcttgccgacacgctgacggag
atcaagacgatctgcgaatgcgggcgcaaggcgacgatgaacctgcgcgtcgacgggaaa
ggccgcccgatccgcgaaggcgaacagacggaaatcggcggcaatgaccgctatgtcgcg
ctgtgccgccgccatttcgtggaacggcgctccggccattga

DBGET integrated database retrieval system