KEGG   Sphingobium chlorophenolicum: Sphch_1464Help
Entry
Sphch_1464        CDS       T01522                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sch  Sphingobium chlorophenolicum
Brite
KEGG Orthology (KO) [BR:sch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sphch_1464
Enzymes [BR:sch01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sphch_1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored AlaDh_PNT_C FAD_binding_3 FAD_binding_2 NAD_binding_7 DAO NAD_binding_8 K_oxygenase Glutaredoxin FMO-like Thi4
Motif
Other DBs
NCBI-ProteinID: AEG49153
UniProt: F6EY47
LinkDB All DBs
Position
1:1580744..1582324
Genome map
AA seq 526 aa AA seqDB search
MLDANLKGQLKAYMANITQPIELVASLDDGAKSRELKTLLEEIAELSDKVSIATGSDKRV
PSFMIRRTGTDIGVTFAGLPMGHEFTSLVLALLQVGGHPSKAAQELIQQIKDIDGDFAFE
TYFSLSCQNCPDVVQALNLMAVLNPRISHTAIDGALFQAEVDARKVMAVPTVFLNGEPFA
SGRMELEQIVAKIDSGAATRAAAKIKAQEPFEVLIVGGGPAGAAAAIYAARKGIRTGVAA
ERFGGQVLDTMDIENFVSVSRTEGPKFAAALEAHVKDYDVEIMNLQKAEKLIPAKTEGGY
HEVVLENGATLKGRTVILSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVKIITSALTTKVDGNGE
RVTGLSYKDRNSGTEHDVELEGIFVQIGLVPNTEWLKDSIALSPRGEIEIDARGETSQPG
IFAAGDCTTVPYKQIVIACGAGSTAALSAFDYLIRLPAAEEAAEAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaatctcaagggccagctcaaggcctatatggcgaatatcacccagccg
atcgaactggtggcctcactggacgacggcgcgaagagccgtgaactcaagactctgctg
gaagagatcgccgaactgtcggacaaggtgtccatcgcgacggggtcggacaagcgcgtc
cccagcttcatgatccgccgcaccggcacggacatcggcgtgaccttcgcgggcctcccc
atgggccatgaattcaccagcctcgtcctcgccctgctccaggtcggcggccacccatcg
aaggccgcgcaggaactgatccagcagatcaaggatattgacggcgacttcgccttcgaa
acctatttctcgctgtcgtgccagaactgccccgacgtggtgcaggcgctgaacctgatg
gcggtcctcaacccccgcatcagccacaccgccatcgacggcgcgctgttccaggcggaa
gttgacgcccgcaaggtcatggccgtccccaccgtcttcctgaacggcgaacccttcgcc
agcggccgcatggaactggagcagatcgtcgcgaagatagacagcggcgccgccacccgc
gccgccgcgaagatcaaggcgcaggagcctttcgaggtgctgatcgtcggcggcggcccc
gcgggcgcggcggcagccatctatgcggcgcgcaagggcatccgcaccggcgtcgcggcg
gaacgtttcggcggccaggtgctcgacaccatggatatcgagaatttcgtctcggtcagc
cgcaccgaaggccccaaattcgccgccgcgctggaagcgcacgtcaaggattatgatgtc
gagatcatgaacctgcaaaaggcggaaaagctgatcccggccaagaccgaaggcggctat
catgaggtcgtgctggaaaacggcgcgacgctgaaaggcaggacggtcatcctctccacc
ggcgcccgctggcggcagatgggcgtccccggcgaggaggaatatcgcaacaagggcgtc
gcctattgcccgcactgcgacggccccctcttcaagggcaagcgcgtggcggtgatcggc
ggcgggaatagcggcgtggaggcggccatcgacctggcgggcatcgtcgcccatgtgacg
ctgatcgagtttgacagccagctccgcgccgacgcggtgctgcaacgcaagctcgccagc
ctgcccaacgtgaagatcatcacctccgccctcaccaccaaagtggacggcaatggcgag
cgcgtcaccggcctcagctacaaggaccgcaacagcggcacggaacatgatgtcgaactg
gaggggattttcgtccagatcggccttgttcccaacaccgaatggctgaaggacagcatc
gccctctccccccgcggcgagatagagatcgacgcgcgcggtgaaaccagccagcccggc
atcttcgcggcgggcgactgcaccaccgtcccctacaagcagatcgtgatcgcgtgcggc
gcgggatcgacggcggcgctgtcggccttcgactacctcatccgtctacccgctgcggaa
gaggctgccgaagcggcctga

DBGET integrated database retrieval system