KEGG   Sphingobium chlorophenolicum: Sphch_1831Help
Entry
Sphch_1831        CDS       T01522                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sch  Sphingobium chlorophenolicum
Brite
KEGG Orthology (KO) [BR:sch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sch03012]
    Sphch_1831
   03029 Mitochondrial biogenesis [BR:sch03029]
    Sphch_1831
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sch04147]
    Sphch_1831
Translation factors [BR:sch03012]
 Eukaryotic Type
  Elongation factors
   Sphch_1831
 Prokaryotic Type
   Sphch_1831
Mitochondrial biogenesis [BR:sch03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Sphch_1831
Exosome [BR:sch04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Sphch_1831
  Exosomal proteins of breast cancer cells
   Sphch_1831
  Exosomal proteins of colorectal cancer cells
   Sphch_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEG49515
UniProt: F6ETM0
LinkDB All DBs
Position
1:complement(1940469..1941659)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFVDYANIDKAPEERERG
ITISTAHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSATDGPMPQTREHI
LLARQVGVPQLVVFMNKVDLVDDAEILELVELEIRELLSSYDFDGDNIPVIPGSAVKALD
GSNDEIGKNAVLKLMAAVDSFIPQPERPIDKPFLMPIEDVFSISGRGTVVTGRVETGIVK
VGEEVEIVGIKDTRKTTVTGVEMFRKLLDEGRAGDNIGALIRGVGREEVERGQVLAKPGT
ITPHTEFDAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDVTGEVILPEGTEMVMPGDNVK
LNIKLIAPIAMDQGLRFAIREGGRTVGAGVVGTISK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggctaagtttgagcggaacaagccgcactgcaacatcggcaccatcggtcac
gtcgaccatggcaagacctcgctgaccgcggcgatcaccaaggtcctcgccgaaaccggc
ggcgcaaccttcgttgactatgccaatatcgacaaggctcccgaagagcgcgagcgcggc
atcaccatctcgaccgcccacgtcgaatatgagaccgaagcccgtcactacgcgcacgtc
gactgcccgggtcacgctgactacgtcaagaacatgatcaccggtgcggcccagatggac
ggcgcgatcctcgtcgtttcggccaccgatggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgccaggtcggcgtgccgcagctcgtcgtgttcatgaacaaggtcgacctg
gtcgacgacgccgaaatcctcgagctggtcgagctggaaatccgcgagctgctgtcgtcc
tatgacttcgacggcgacaacattcctgtcatccccggctcggccgtgaaggcgctggac
ggttcgaacgacgaaatcggcaagaatgccgttctcaagctgatggctgccgtcgactcg
ttcatcccgcagccggagcgtccgatcgacaagcccttcctgatgccgatcgaagacgtg
ttctcgatttcgggccgcggcaccgtcgtgaccggccgcgtcgagaccggcatcgtcaag
gttggtgaagaagtcgaaatcgtcggcatcaaggacacccgcaagaccaccgtcaccggc
gtggaaatgttccgcaagctgctcgacgaaggtcgcgctggcgacaatatcggcgcgctg
atccgtggcgtgggccgcgaagaagtcgagcgcggtcaggttctggccaagcccggcacc
atcaccccgcacaccgaattcgacgcggaagtctacgtcctgtcgaaggaagaaggcggt
cgtcacaccccgttcttcgccaactatcgcccgcagttctacttccgcaccactgacgtg
accggcgaagtgatcctgcccgaaggcaccgagatggtcatgcccggcgacaatgtgaag
ctgaacatcaagctgatcgctccgatcgccatggaccagggtctgcgcttcgccatccgc
gaaggcggtcgcaccgtcggcgcaggggttgtcggcacgatctcgaagtaa

DBGET integrated database retrieval system