KEGG   Sphingobium chlorophenolicum: Sphch_2430Help
Entry
Sphch_2430        CDS       T01522                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00620  Pyruvate metabolism
sch00680  Methane metabolism
sch01100  Metabolic pathways
sch01120  Microbial metabolism in diverse environments
sch01200  Carbon metabolism
Module
sch_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sphch_2430
  09102 Energy metabolism
   00680 Methane metabolism
    Sphch_2430
Enzymes [BR:sch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sphch_2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase ACT_5
Motif
Other DBs
NCBI-ProteinID: AEG50088
UniProt: F6EYN8
LinkDB All DBs
Position
1:2588039..2590735
Genome map
AA seq 898 aa AA seqDB search
MATPAPSSAPAITQNPDIRYLGRLLGDVIRAYGGEKIYKQTEYIRSASVDRARGLHGADV
VDTGLDALSLDDTLSFVRGFMLFSMLANLAEDRQGVAAEPGADVASAVEKLDSHGIGREA
VLDLLSHALIVPVLTAHPTEVRRKSMIDHKNRIADLMLLKDGGRTETDEGENLDEAIFRQ
IALLWQTRPLRREKLFVADEIENVLAYFRDVFLPVLPALYARWERVLGARPQSFLRVGNW
IGGDRDGNPFVQAPQLRLALAKGCEAALTFYMGALHALGAELSLSTELAHVPQSVLDLAD
ASGDNSPSRQDEPYRRAISGIYARLAATYQALIGKNPSRPSTLKGQAYAIPADLRRDLVT
VAQGLASEGGGALASGGALGRLIRAVETFGFHLATLDMRQNSDVHQSVVAELLKVAGVEA
DYAALDEYARIALLRRELANNRPLGTRFSEYSEQTASELAIVHAAAEAHRVYGPQCITHY
IISKAESVSDLLEVNIILKEAGLWRIGADGAPQAAIMAVPLFETIADLEAAPSIMTAYFG
LPEIAGVVRGRGHQEVMIGYSDSNKDGGYITSTWGLFQASKALAPVFADAGTAMQLFHGR
GGAVGRGGGSSFAAIQAQPKGTVQGRIRITEQGEVIAAKFGTRDVAMTNLEAMTSATLLA
SLEPEAISDRDAARFAAAMDQLSKTAFAAYRDLVYGTEGFKEFFRQLTPIQEISGLKIGS
RPASRTKSTRIEDLRAIPWVFSWAQARVMLPGWYGVGHALSAFEDKVLLADMAQHWSFLQ
SALANLEMVLAKSDLGIAAHYLPLVEDQARGAEIFDRIRDGWDKTHDGLLAATGQSRLLE
KNPKLDSSIRLRLPYIEPLNLLQVELMKRHRSGEDDPRIKEGIELSINAIATALRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcccgcaccctcttccgcgcctgcgatcacgcagaaccccgatatccgctat
ctcggccggctgctgggcgacgtcatccgcgcctatggcggggagaaaatctacaagcag
accgaatatatccgctccgcctcggtcgaccgggcgcggggcctgcacggcgcggacgtg
gtcgacaccggcctcgacgcgctcagcctggacgacacgctcagcttcgtgcgcggtttc
atgctcttctccatgctcgccaacctggccgaggaccggcagggcgtcgccgccgaaccg
ggcgcggacgtcgcctccgccgtggaaaagctcgactcccacggcatcggccgtgaagca
gtgctcgaccttctttcccacgccctgatcgtcccggtcctcaccgcccacccgaccgaa
gtgcggcgcaagagcatgatcgatcacaagaaccgcatcgccgacctgatgctgctcaag
gatggcggccggacggaaaccgacgagggcgaaaatctggacgaagcgatcttccgccag
atcgcgctcctttggcagacccgcccgctccgccgcgaaaagctgttcgtcgcggacgag
atcgaaaatgtcctcgcttatttccgcgacgtcttcctccccgtcctgcccgccctctac
gcccgctgggaacgcgtccttggcgcgcgcccgcaaagcttcctgcgcgtcggcaactgg
atcggcggcgaccgcgacggcaatcccttcgtgcaggccccccagcttcgcctcgcgctg
gcgaagggctgcgaggccgcgctgaccttctatatgggcgcgctccatgcgctgggcgcg
gaactctccctctccaccgaactcgcccatgtgccccaatccgtgctcgatctggccgac
gccagcggcgacaattcgcccagccgtcaggacgaaccctatcgccgcgccatttccggc
atctacgcccgtctggccgccacttaccaggcgctgatcggcaagaatccctctcgcccc
tccaccctcaaggggcaagcctatgccatccccgcagacctgcgccgcgatctggtcacg
gtggcgcagggcctcgccagcgaaggcggcggcgcactggcatccggaggcgcgctcggc
cgcctgatccgggcggtcgagacattcggcttccacctcgccacgctcgacatgcggcag
aatagcgacgtccaccagagcgtggtggccgaactgctcaaggtcgccggggtcgaggcg
gattatgccgcgctcgacgaatatgcccgcatcgccctgctgcgccgcgaactggcgaac
aaccggccgctcggcacccgcttctcggaatattcggagcagaccgcctccgaactcgcc
atcgtccacgccgcggcggaggcgcaccgcgtctacggcccgcaatgcatcacccattat
atcatctcgaaggcagagagcgtctccgacctccttgaagtcaacatcatcctcaaggaa
gcgggcctgtggcgcatcggcgcggacggcgctccgcaggccgcgatcatggcggtgccg
ctgttcgaaaccatcgccgaccttgaggccgcgccgtcgatcatgaccgcctatttcggc
ctgcccgaaatagcgggcgtggtgcgcggacggggccatcaggaagtgatgatcggctat
tccgacagcaacaaggatggcggctacatcacctccacctgggggctgttccaggccagc
aaggcgctggcccccgtctttgccgacgcgggaaccgccatgcagcttttccatggccgg
ggcggcgcggttgggcgcggcgggggttcctccttcgcggcgatccaggcccagcccaag
ggcacggtgcagggccgcatccgcatcaccgaacagggcgaggtgatcgccgccaaattc
ggcacccgcgacgttgccatgaccaatttggaggcgatgaccagcgccaccttgctcgcc
tcgctcgaacccgaagccatttcggaccgcgacgccgcccgcttcgccgccgccatggac
caattgtcgaagaccgccttcgccgcctatcgcgacctcgtctacggcacggagggcttc
aaggaattcttccgccaactgaccccgatccaggagatttccggcctcaagatcggctcc
cgccccgccagccgcacgaagagcacccggatagaggatctgcgcgccatcccatgggtg
ttcagttgggcgcaggcgcgggtgatgctgccgggctggtatggcgtgggccatgcgctc
agcgcgttcgaggacaaggtgctgctggcggacatggcgcagcactggtccttcctgcaa
tcggcgctggcgaatctggagatggtgctggccaagtcagacctcggcatcgccgcccat
tatctgccgctggtggaggatcaggcgcggggggccgagattttcgaccgcatccgcgat
ggctgggacaagacgcatgacggcctgctcgccgccaccggccagtcgcgcctgctggag
aagaatccgaagctggacagctcgatccgcctgcgcctgccctatatcgagcctttgaat
ctgctccaggtcgaactgatgaagcgccaccgcagcggcgaagacgacccgcgcatcaag
gagggcatagaattgtcgatcaacgccatcgcgactgcgctcaggaacagcggctga

DBGET integrated database retrieval system