KEGG   Sphingobium chlorophenolicum: Sphch_3249Help
Entry
Sphch_3249        CDS       T01522                                 

Definition
(GenBank) Betaine-aldehyde dehydrogenase
Organism
sch  Sphingobium chlorophenolicum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEG50859
UniProt: F6F347
LinkDB All DBs
Position
2:383764..385263
Genome map
AA seq 499 aa AA seqDB search
MTTAHPRATGYSIGHRQHLFIGGEWRRSAKGGVIDVISPTDELVADQVAAATPEDIDLAV
TAAREAFDQGPWPHMAPSERAATLRRVAANLRERLSDTAWATTLEMGAPLAMARTIATRS
AQLFDDYAEIAETHPTEDVRPRQAGGYTVVVSEPVGVVAAIVPWNGPALLTALKVAPALA
AGCTVVLKPAPETPLDAYILAECIEAAGVPPGVFNLVVADREASDRLIRHPGIDKVSFTG
STAVGKHILEVASQRVLRVSLELGGKSAAIVLDDANMETVVAQLAGEVCTNTGQVCASLT
RMIVPRGKMADYAEALGATVSKMSVGDPFQDGVQVGPLAMGRQRSRVEDYIRKGVDEGAQ
LVSGGRRPGHVERGFFIEPTVFSNVSPSMTIAREEIFGPVASIIAHDGPEDAVRIANDTR
YGLHGAVFTEDPDAGYRVARQMQTGSIGFNRREIDWSMPFGGFKESGLGREGGREGYRQY
IELKSIYMPQLPSRLKKQQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacggcccaccccagagcgactggatattcgattggacatcggcagcacctgttc
atcggtggggagtggcgtcgatcggccaagggcggcgtaatcgatgtcatctcgcccacg
gatgaactcgtcgcggatcaagtcgcggccgctacgcccgaagatatcgacttggccgtt
acggcggcgcgcgaagcgtttgatcaaggtccctggccccacatggccccgtcggagcgc
gctgcgaccctgcgccgagtcgccgccaatctgcgcgagcggctgtccgacacggcctgg
gcgacgacgctagaaatgggtgcgcccttggctatggcgcgcaccatagccacacgttct
gcgcagttgttcgacgactatgccgagatcgccgaaacgcacccgaccgaagacgtccgt
ccgcgtcaagccggcggctataccgttgtcgtcagtgagccagtgggcgtcgtcgcggcg
atcgtcccgtggaacgggccggccctgctgaccgcactgaaggttgcgcccgcgttggcc
gccgggtgcaccgtggtgctcaaaccagcgcccgaaacgccgcttgacgcctatatcctg
gctgaatgtatcgaggcggcgggcgtaccgccgggggtcttcaatctggtcgtggccgac
cgcgaggcgagcgaccggctgatccgccaccccggcatcgacaaagtcagcttcaccggc
agtaccgcagtgggcaaacacatcctggaggtggcctcgcagcgtgtgttgcgcgtcagc
ctggaactgggggggaaatccgccgcgatcgtgcttgacgacgcaaacatggagacggtc
gtcgcccagctcgccggcgaggtgtgcactaacaccggccaggtctgcgcttctctgacc
cgtatgatcgtgccgcgcggcaagatggcggattatgccgaggcgcttggcgcgacggtc
tcgaagatgtcggtcggcgatccgtttcaggatggtgtccaggtcgggccgctggcgatg
gggcgtcaacgctcgcgggtcgaggactatattcgaaaaggcgtcgacgagggcgctcaa
ctggtcagcggcggacggcgaccagggcatgtggaacgcggctttttcatcgaaccgacc
gtcttcagcaatgtcagcccgtcgatgactatcgcgcgcgaagagattttcggaccggtg
gcgagcatcatcgcgcatgacggacccgaagatgccgtgcgtatcgcgaacgacacgcga
tacggcctgcatggagcggttttcaccgaagatcccgatgcgggctatcgtgtcgcgcgc
cagatgcagacgggcagcatcggtttcaatcgccgcgagatcgactggtcgatgcccttc
ggcgggttcaaggaatccggccttggccgtgaaggtggccgggaaggctatcggcaatat
atagagctcaagagcatctatatgccgcaacttccctcgcgcctgaagaaacaacaatag

DBGET integrated database retrieval system