KEGG   Sphingobium chlorophenolicum: Sphch_3619Help
Entry
Sphch_3619        CDS       T01522                                 

Definition
(GenBank) Betaine-aldehyde dehydrogenase
Organism
sch  Sphingobium chlorophenolicum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEG51209
UniProt: F6F0Z3
LinkDB All DBs
Position
2:complement(820585..822060)
Genome map
AA seq 491 aa AA seqDB search
MTDTLLNLASPEKLFIGGDWSSSSASDGIEIISPATEEKVGRVAKATTADMDRAVAAARN
AFDNGPWPRMTGPERAVYLRRIAGEMAKRADDFARAWSLQVGMPYAQSVSTAPFMGGYYT
YAADLAEKGFEEVRPALAGGHAIVVREPVGVVAAVVPWNAPLATLSLKVAFALAAGCTII
AKPSPETPLEALILAECIAAAEVPEGVFSVLTADRDVSDYLIRHEGVDKVSFTGSTAAGL
HIASVVSGRSGRITTELGGKSAAIILDDADIGKVVEGIMPNLVGLCGQQCAAFSRILVPA
SLKGAVEEALAAAMQYVQVGDPFAETTQMGPLVTQRQHGRVLDYIRQGKAQGARVVTGGN
RPAHLDKGWFVEPTLFTDASNDMTIAREEIFGPVGTIIAYGSEEEAIAIANDNIYGLSGG
VFTQDVERAYRVARRIRTGNFGHNGRVIDYTIPYGGFKQSGVGREGGEEGLHGFTEIKAV
FMQELPAHLKG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacgctcctcaacctcgccagccctgaaaagctgttcatcggcggcgactgg
tccagttcttcggcctccgacggtatcgagatcatctcgcccgcgacggaggaaaaggtg
ggccgcgtcgcgaaggcgaccaccgccgacatggaccgcgccgtcgcggcggcgcgcaac
gccttcgacaacggcccctggccgcgcatgaccgggccggagcgcgccgtctatctgcgc
cgcatcgcgggggaaatggccaagcgcgcggacgatttcgcccgcgcctggtcgttgcag
gtgggcatgccctatgcgcagtcggtttcgaccgcgccgttcatgggcggatattacacc
tatgccgccgatcttgcggaaaagggttttgaggaagtgcggcccgccctggccgggggg
catgccatcgtcgtgcgcgagccggtgggcgtcgtcgccgccgtggtgccgtggaacgcg
ccgctcgccacgctctctttaaaggtggctttcgcgctggccgcgggctgcaccatcatc
gccaagccttcgccggaaacgccgctggaggcgttgatcctggccgaatgcatcgcggcg
gcggaagtgcccgaaggcgtgttttcggtgctgacggcggatcgcgacgtgtccgactat
ctgatccggcacgaaggggtggacaaggtcagcttcaccggatcgaccgctgccggcctg
cacatcgcctccgtcgtcagcgggcggtcggggcgcatcacgacggaactgggcggcaag
tccgccgccatcatcctggacgatgccgacatcggcaaggtggtcgaaggcatcatgccc
aacctggtcgggctatgcggccagcaatgcgccgccttcagccggatattggtgcccgct
tcgctgaagggcgcggtggaggaggcgctggccgccgcgatgcaatatgtgcaggtgggc
gatcccttcgccgaaacgacgcagatggggccgctcgtcacccagcgccagcatggccgc
gtgctggactatatccggcagggcaaggcgcagggcgcccgcgtcgtcacgggcggcaac
cgccccgcgcatctcgacaagggctggttcgtggaacccaccctgttcaccgacgccagc
aacgacatgaccatcgcccgcgaggagattttcggacccgtgggcacgatcatcgcctat
ggcagcgaggaagaggcgatcgccatcgccaacgacaatatctacggcctgtcgggcggc
gtgttcacgcaggatgtcgagcgcgcctacagggtcgcccggcgcatccgcaccggcaat
ttcggccataatggccgggtcatcgactacaccatcccctatggcggcttcaagcagtcg
ggcgtgggacgcgagggcggcgaggaagggctgcacggctttaccgagatcaaggccgtc
ttcatgcaggaactgcctgcccatctgaagggctga

DBGET integrated database retrieval system