KEGG   Streptomyces collinus: B446_04650Help
Entry
B446_04650        CDS       T02787                                 

Definition
(GenBank) modular polyketide synthase
Organism
sci  Streptomyces collinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 PS-DH KR Ketoacyl-synt_C PP-binding adh_short KAsynt_C_assoc adh_short_C2 Condensation Thiolase_N Epimerase GDP_Man_Dehyd Sacchrp_dh_NADP 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AGS67758
UniProt: S5ULG9
LinkDB All DBs
Position
complement(1133779..1147581)
Genome map
AA seq 4600 aa AA seqDB search
MPANESPKQTPEPSLTTSEGVRAWLASAVAEAAGTDPARIDPDRPLTEFGLGSRHLVALA
AELGTLTGRPVEPSLVFNHPTIAAVAEAVLAPAPTPGPASAPTTSPEPAAARGGWGDEVA
IISMACRFPGGADDPEALWRLLAAGEDAVREVPAGRWDTHGLYDPDPEATGKAYTLRGGF
LDGGIDRFDAAFFGISPREAAAMDPQQRLLLQTAWETVERAGILPQSLNGSSTGVYLGLY
ESGYLAAAPLGQLDGHVGTGSAASVASGRIAYTLGLRGPAVTVDTACSSSLVALHLAARA
LASGECDLALAGGATLLVTPRGHVEFSRLRGLSPSGRCSPFSADADGVVWAEGCGLVLLK
RLADARRDGDRVLAVVKGSAINQDGRSQGLSAPNGPAQERVLRAALDAAGLAPHDLDHVE
AHGTGTPLGDPIELRALANVFGPDRPAERPLAIGSLKSNIGHAQAAAGIGGVIKTVLALG
HEELPASLHADQLTDHLDWTGSGLRVQSTGGAWPRTADRVRRAGVSAFGISGTNAHVILE
EPEGAEEDEGAEAPGPAGQGPVDLPAPTLFPLSARSLTSLHGQAARLLGALEADPAAPLT
AVAATLAHHRTHFDHRAVVQAADRDGLLDGLRALADGRPDPDLTAGPEQAGPTGKLAFVF
PGQGSQWAGMARDLLERDPVFADELDRCDAALRPFTEWSVTAVLRGEAGAPPLDRVDVVQ
PALFAVMVSLAAVWRARGVRPDAVIGHSQGEVAAACVAGALSLNDAAAVVALRSQALTGL
SGSGTMAVVALPHSEVADLLGDDVSVAAVNSGRATVVAGAVEPLEDLLTALEARQVFVRR
LDVDYASHSARVEPVRDRIVDELDGVVALPTGIAWYSTVTGEPVTEELDAGYWYTNLRET
VRFAPTVERMLADGYRHFVELSPHPSLLTALRTVGEDTGRDLTATGSLRRDESGPACLDR
ATAELHVHGRHVDWRRLVRPGAGADLPTYAWDTPRHWIEPGAATAGPALFDRAAHPLLGI
QLQSADETRWTFRDEWSPATAGWLADHTVFGRTVVSGTTLLELCRAALAVARPDEPADVA
GLLLLAPLVLPATGTVEVSVEVVTAQPGAEVTVHSRPRGQDASGWTLHATATASAGESEP
DPAGGPPVWPGTAEEAWTEPTYARLAALGLGYGPAFQAVRSAVTTGDGELLARIALPATA
RDVADPYPVHPALLDAALHVTAALAPADGRALLPVAVGRAVLPPGGAHELTARVRRTGGS
GTDLTLDVTLWDADGLPAGRLENVRLRAADPADLDAGSENARHLYEIAWTTVAEEPPAHR
AEPDADLVVRVWPDVAADEEPARAAHESAATALAELQELIALPEDRAPRRTVWVTRAAVA
AAEGDAVTGYARSVLWGLARSARAEHPDLGLTLLDVDVDADLPGGVPASVLATAAALADE
PELALRGGNLLAPRLVRARPANVTDTAERAGPAAPVLPTDGTVLITGGLGAVGRHIARLL
AGRGVPRLVLTARQGAQDPRAAGTVEELAGLGAEAEVVACDVTDPAAVAEAVEHAGQRLP
LRGVVHCAGALDDGAITALTPERLARVLRPKADGALHLHRLTADLPLGLFLLVSSAAGVV
GNAGQGNYAAANVLLDQLAHHRRAQGLPAVSVSFGAWAGEGLAAAHADLDRMARLGHRAL
TPDQGRDLVALALRRTAPHLVAWALDLPRLRASGAASTALWRSLLPAPRTADAADALADR
LARLPEAERAARVLALVRDEASRALGLRSAESVRPDQPLRDLGMDSVTAVELRNRIGARL
GTRLPATLLFDHPTADRLAVYLLKQVPGGTAGTTRQAPAAPVSASGPAADEPIAVVAMAC
RLPGGITDPDGLWRLVAEGRDAVGPFPAGRWDVESLYDPDPDALGKSYAREGGFLDDIES
FDAGFFGITPREAAAMDPQQRLLLETSWEALERAGIVPAALAGSTTGVYVGMFGSDYLAG
SRLDQLDGYVGTGSALSVASGRLAYALGLHGPALTVDTACSSSLVATHLAAQALRAGECD
LALAGGVTLMVTPQTFVEFSRLRGLSPTGRCRSFSDDADGAIWAEGAGMLVLKRLSDARR
DGDEVLAVLRGTAVNQDGRSQGLSAPNGPAQEQVIRRALRQSGLDPADIDYVEAHGTGTT
LGDPIEANALAEVFAGTRPQDRPLYLGSLKSNIGHVQAASGVAGLIKVVQSLRHGTLPPT
LHAGTPSRHVEWDGSGLALLQEPVAWPATGERVRRAGISAFGISGTNAHVVVEEAPARPG
ERAQVRELPDGKQLFVLSARSEAGLRGQASRLARHLTTGTGPSDVARTGLPDVARTLATH
RSHFEWRTAVVAGDREELLTALKPLDPSTGGRKPLTAPREDQTGKVAFVFAGHGGQWTGM
GLELLAQSEAFRAELTRIDAAVERHAGWSVLNVLRAPEEFSPLDRTEYLQPVLFAVNAAL
AAAWRELGVTPDAVVGHSLGEIAAAYCAGALTLDEAVTAVTARAAAVVPLVGHGGMLAVE
LPAAEVEKLLEPYTGRLFTAAVNSPGATAVSGEAEALAALRRELDERGVPARVLSTPFAS
HTPLMEPLRDELLDRFSGIGGTRTATTLYSSVRAEPVDGADLDADYWFANLRRPVRFAET
VARMLDDGYRYFVELSPHPSLTSAIEAVAAESGTDAVGIGSLRRGRDGHDVLLGRLGELY
TAGHTPDWTALFPHGRRADLPTYAFARERHWLAPVRTGATGIPPLLGTHVQASDEPGRDL
FQSEIDLADSRFAYLSDHRVTGEVWLPGAAFLDMVLEAAASLSGGAETRLADVRFLQPLR
LDAGGPVRLQLVLRPAEDGSRDFSVASAAGERRWERHVTGRLLTGPAEPAPGPDPDLAAL
RARCTEPVDLPAVYAGLAALGIEYGPAFRGLTDGHRDGGGAALARLAARPAAGHLLHPAT
LDAAFHTAALPATAPQGRAFVPAGAGHLRFTGTRSTPAWAACDLRAVDGDTAVLDLRLWD
EDGRLVLAADDFRLTALSPLDGALFETRWQPRPEAQAPPADGGWLILADGTGVADELARR
LGDSVPHAVVRQGTAYGTDGPGRHVLDPADPAQWARLLDEAFADAPPARVVQLTALDAPP
VTDARAAEEAARHCCLTTLHLVRALTGHRRPNAPAPRLFVVVRGSQPAGDSTEVTRPEQA
LAWGFGLTVAQEHPELATTVIDLPAEGGDDRLWTQLRHADDERLVALRGSGRLVPRLART
RPDHDGADPGQPDGVHLITGGLGGLGRVVAERLVRQGARRLALLSRGTPDAAATAFVRDL
EERGVDVHLARADVADRAALAAALDAVRAAAGPVVTVVHAAGVLDDAVLANLTEERVRRV
LAPKVLGTALLTELVPEARNLVLFASAAGLLGSPGQGPYSAANAFLDAWAHHLSLTGRRA
LSLDWGAWSGVGMVAGSGTRAAETGRSGLVAFPPQDGGELFERVLASGRRQLAPIALDWD
LLALDPDAARGRPLLADLITVPAGGADTDDLVRRVFGATTAQERAEWLETYVRDRVGEVS
GGAVDVFATTALKELGLDSLMLVRLRNAFARELGVELPAADMFSATDIRGLAGTLAAALP
ERAAPAGGTAPAGRTGGAGAGQDVPETELRPATRDVVRLLRSAQPDMPDAAHGVGLAVRL
TTPATRDGLTGILDRLAARHAALRTAVVTGDEGGRQLRVDRRPPAPLLRWTEAAEADAAE
RLRLLLEPPFDLAVAPLWRFELVDGDPRGQILVFGAHHAVSDLQSLLLVAAEIDAELSGT
PLDATVTNRDIDLLIEAQRGGGTGPGDDWRAAFEGSERLDLTLAHPRPPVRSYRSGSVTV
TLPEGLTERVTAAAGALGVTPAAFCLGTLTVLLARERERERFVLAVPVDTRIHADAYGAV
GFFGVPVPFPAQAAAHERVADVLTRTDQRLRQILAKGAMFSDVLATLARQGLHRPAAPLV
EVYFNYVRFSGELKHLEVLPAGVGHTDLDLMVTMTPDAGTVRLDHNTDILDADTATALGE
EFLRLLARTAEDATAPVRTAPPVSAEEPAESVSTALTVPVEEPARSASAAPPAPVEGPRV
ALAATFALGNLPLMCGAALEDERATVTEAPYHQVLAALRDPSGVLADPATDVRVVLLRAA
DLERFGPVDDTVLAELRAAYPAALKALAERTRGPLVVGVLPTARGTDRCHAWERAVAADL
TGLPGIAVLGPDEWTRYHSVDNRFDERTERLAHLPFTPEFQAAVALRLAETVRAVRRPVP
KVIAVDGDETLWGGVAGEIGPDAVDLTGPRASLARRLLRWRTAGVLLALVSNNDEATVRA
VLDRPDSLLKAEHFSVISAAWGPKPGRLADAARTLDLGLDSFLFLDDNPAEIARMRAALP
QVLSVTCPPAGGLDAFLDRLWPLVPAAATAEDALRARFYAQERERDAVRESAGFEEFLAD
LDLVVDIRELSDADAERGEQLVRRTNQFTLRARSADGGDLARWRERGEVWTASARDRFGD
YGQIALLAFGADGDRLDVHAWLMSCRALGRGVEERLLAWLADRAERLGRTEVRIVAERTP
RNAPARRLLAALGGGDPDGERLEVVAGPERLRAFRSWEQP
NT seq 13803 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgaacgagtccccgaagcagacccccgagccgtccctgacgacctccgagggg
gtccgggcctggctggcatcggccgtcgccgaggcggccggcaccgacccggcccggatc
gacccggaccggccgctcaccgaattcggcctgggctcccgccacctggtcgccctcgcc
gccgaactcggcacgctgaccggccgccccgtcgaaccgtccctcgtcttcaaccacccc
acgatcgccgccgtggccgaggccgtcctcgccccggcaccgaccccgggccccgcatcg
gcccccacgacgtcaccggagccggccgcggcccgcggcggctggggcgacgaggtggcg
atcatctccatggcctgccgtttccccggcggcgccgacgaccccgaggcgctgtggcgg
ctgctggccgcgggcgaggacgccgtccgcgaggtgccggccgggcgctgggacacccac
ggcctgtacgaccccgaccccgaggccaccggcaaggcgtacaccctgcgcggcggcttc
ctcgacggcggcatcgaccgcttcgacgcggccttcttcggcatctccccacgcgaggcc
gccgccatggacccgcagcagcggctgctcctgcagaccgcctgggagaccgtcgaacgc
gccgggatcctcccgcagtccctcaacggcagctccaccggcgtctatctcggcctctac
gagagcggctacctggccgccgccccgctcgggcagctcgacggccacgtcggcaccggc
tccgcggccagcgtcgcctccgggcgcatcgcctacaccctcggcctgcgggggcccgcg
gtgaccgtcgacaccgcctgctcgtcctcgctggtcgccctgcacctcgccgcgcgcgcc
ctggcgagcggcgagtgcgacctcgcgctggcgggcggggccacgctgctcgtcaccccg
cgcggacacgtcgagttcagccggctgcgcgggctgtccccgtcgggccggtgcagcccc
ttctccgccgacgcggacggggtcgtgtgggccgagggctgcggcctcgtgctgctgaag
cggctcgcggacgcgcgccgcgacggcgaccgggtcctggccgtcgtcaagggttcggcg
atcaaccaggacggccgcagccagggcctcagcgcccccaacggcccggcgcaggaacgg
gtgctgcgcgccgccctggacgcggccgggctcgccccgcacgacctggaccacgtggag
gcccacggcaccggcaccccgctcggcgatcccatcgaactacgggcgctcgccaacgtg
ttcggcccggaccgcccggccgaacgccccctcgccatcggctccctcaagtcgaacatc
ggccacgcccaggccgccgccggcatcggcggtgtcatcaagaccgtccttgccctcggc
cacgaggagcttccggcgtcgctgcacgccgatcagctcaccgaccacctcgactggacc
ggcagcggcctgcgcgtgcagagcaccggcggtgcctggccgcgcaccgccgaccgggtg
cgccgggccggcgtcagcgcgttcgggatcagcggcaccaacgcgcacgtgatcctggag
gagcccgagggagccgaagaggacgagggggccgaggcgcccggccccgccgggcagggc
cccgtggatctgcccgcccccaccctcttcccgctgtccgcccgcagcctcacctccctg
cacggccaggccgcccggctgctcggcgcgctggaggcggacccggcggcgcccctgacc
gcggtcgccgcgaccctcgcccatcaccgcacccacttcgaccaccgggccgtcgtccag
gcggccgaccgcgacgggctcctcgacggcctgcgcgccctcgccgacgggcgccccgat
cccgacctcaccgcgggccccgagcaggccggccccaccggaaagctggccttcgtcttc
cccgggcagggcagccagtgggccggcatggcccgtgacctgctggagcgggaccccgtc
ttcgccgacgagctggaccgctgcgacgccgccctgcgcccgttcaccgagtggtccgtg
acggccgtgctgcgcggcgaggccggcgccccgcccctggaccgggtggacgtcgtacag
cccgccctgttcgccgtgatggtgtccctggccgccgtgtggcgggcccgcggcgtccga
ccggacgccgtgatcgggcacagccagggcgaggtcgccgccgcctgcgtggccggcgcg
ctcagcctcaacgacgcggccgccgtggtcgccctgcgcagccaggccctgaccgggctg
tccggcagcggcaccatggccgtcgtcgcgctgccccactccgaggtggcggacctgctc
ggcgacgacgtctcggtcgccgccgtcaacagcggccgtgcgaccgtcgtcgccggcgcc
gtcgaaccgctggaggacctgctcaccgccctcgaggcgcgccaggtcttcgtccgccgc
ctcgacgtcgactacgcctcccacagcgcccgggtggaaccggtcagggaccggatcgtc
gacgaactcgacggcgtggtcgccctccccaccggcatcgcctggtactccaccgtcacc
ggcgaaccggtcaccgaggagctggacgcgggctactggtacaccaacctgcgcgagacc
gtccgcttcgcgccgaccgtcgagcgcatgctcgccgacgggtaccgccacttcgtcgag
ctgagcccgcacccctccctgctcaccgccctgcgcacggtgggcgaggacaccggccgg
gacctgaccgcgaccggctcgctgcgccgcgacgagagcggtcccgcctgcctcgaccgg
gcaaccgccgaactccacgtccacgggcggcacgtcgactggcggcggctggtccggccc
ggagccggcgccgacctgccgacctacgcctgggacacgccgcgccactggatcgaaccc
ggggccgcgaccgccgggcccgccctgttcgaccgggccgcgcacccgctgctcggcatc
cagctccagtccgccgacgagacccgctggaccttccgcgacgagtggtcgccggccacc
gccggctggctggccgaccacaccgtcttcggccgcaccgtcgtctccggcaccaccctg
ctggaactgtgccgcgccgccctcgccgtggcccgcccggacgagcccgccgacgtcgcc
ggcctgctgctgctcgcacccctggtgctccccgccacgggcaccgtcgaggtctccgtc
gaggtcgtcaccgcccagcccggcgccgaggtgaccgtgcacagccgcccgcgcggccag
gacgcctccggctggaccctgcacgccaccgccaccgcctcggccggggagtccgagccg
gacccggcgggcggccctccggtgtggccgggcaccgccgaggaggcgtggaccgagccg
acctacgcacggctggccgccctcggcctcggctacggacccgccttccaggccgtacgg
tcggcggtcaccaccggcgacggagaactcctcgcccgcatcgcgctgcccgccaccgcc
cgcgacgtggccgacccgtacccggtgcacccggccctgctggacgccgccctccacgtg
accgccgccctggcaccggccgacgggcgcgccctgctccccgtcgccgtgggccgcgcg
gtcctgccgcccggcggcgcgcacgagctgaccgcacgggtacggcgcaccggcggctcc
ggcaccgacctcaccctggacgtcaccctgtgggacgccgacggcctgcccgccggccgc
ctggagaacgtacggctgcgcgcggcggacccggccgacctcgacgcgggctcggagaac
gcccggcacctgtacgagatcgcctggacgacggtcgccgaggagcccccggcgcaccgg
gccgaaccggacgccgacctcgtcgtacgggtctggccggacgtggcggcggacgaggaa
cccgcccgtgcggcccacgagtcggcggccaccgcgctcgccgaactccaggagctcatc
gctctgcccgaggaccgggcgccccggcggaccgtgtgggtgacccgtgccgcggtcgcc
gccgccgagggcgacgcggtgaccggctacgcgcggtcggtcctgtggggcctggcccgc
agcgcccgggccgaacacccggacctcgggctgaccctgctcgacgtcgacgtcgacgcc
gatctgccgggtggtgtccccgcgtcggtgctcgcgaccgccgccgccctcgccgacgag
cccgaactcgcgctccgaggaggcaacttgctggctccccggctggtgcgtgcccgtccg
gcgaacgtcacggacacggcggagcgcgcgggccccgcggccccggtcctgcccacggac
ggcaccgtcctgatcaccggcgggctgggagccgtcggccggcacatcgcccggctgctc
gccggacgaggggtcccgcggctggtgctgaccgcacgccagggcgcccaggacccccga
gccgccgggaccgtcgaggaactggccgggctcggcgccgaggcggaggtcgtcgcctgc
gacgtcaccgatccggccgccgtggccgaggccgtcgagcacgccgggcaacggcttccc
ctgcgcggtgtcgtgcactgcgcaggggccctggacgacggcgcgatcaccgcgctgacg
cccgagcgtctcgcgcgggtcctgcggcccaaggccgacggcgccctccatctgcaccgg
ctcaccgcggacctcccgctcggcctcttcctgctcgtctcctccgcggcgggtgtcgtc
ggcaacgccggacagggcaactacgcggccgccaacgtgctgctcgaccagctcgcccac
caccggcgggcccagggcctgcccgcggtctccgtgtccttcggcgcctgggccggtgag
ggcctggccgccgcccacgcggacctggaccgcatggcccggctcgggcaccgcgcgctc
actccggaccagggccgcgacctggtggcgctggccctgcggcgcaccgccccgcacttg
gtcgcctgggccctcgacctgccccgcctgcgcgcctccggcgccgcctcgaccgccctg
tggcggtcgctgctgccggcgccgcgcaccgcggacgccgctgacgccctcgccgaccgc
ctggcccggctgcccgaggccgagcgggccgcacgtgtcctcgccctggtccgcgacgag
gcctcacgcgccctcgggctgcgctcggccgagtccgtgcgccccgaccagccgctgcgc
gacctcggcatggactccgtcaccgccgtcgaactgcgcaaccgcatcggtgcccgcctc
ggcacccggctgcccgccaccctcctcttcgaccaccccaccgccgaccggctggccgtg
tatctgctgaagcaggtgccgggcggtacggccggcaccacccggcaggcccccgccgcc
cctgtctccgcttccggccccgccgccgacgagcccatcgccgtcgtggcgatggcctgc
cggctgcccggcgggatcaccgacccggacggcctgtggcgcctggtcgccgagggacgg
gacgcggtcggcccgttcccggccggacgctgggacgtcgagtccctgtacgaccccgac
ccggacgcgctcggcaagtcctacgcccgcgagggcggcttcctcgacgacatcgagtcc
ttcgacgccggcttcttcggcatcacgccgagggaggccgccgccatggacccccagcag
cgactgctgctggagacctcgtgggaggccctggagcgcgccggcatcgtgccggccgcg
ctcgcgggcagcacgaccggcgtctacgtcggcatgttcggcagcgactacctcgccggt
tcccggctcgaccagctcgacggctacgtcggcaccggttcggcgctcagtgtcgcctcc
ggccggctggcctacgcgctgggcctgcacggccccgcgctgaccgtggacacggcctgc
tcctcctccctggtggcgacccatctggcggcccaggcgctgcgcgccggggagtgcgac
ctggccctggccggcggggtgacgctgatggtgaccccgcagaccttcgtggagttcagc
cggctgcgcggcctgtccccgaccggccgctgccgctccttctccgacgacgccgacggc
gcgatctgggccgagggcgcgggcatgctcgtgctcaagcggctctccgacgcgcgacgc
gacggcgacgaggtgctggccgtgctgcgcggtacggccgtcaaccaggacggccgcagc
cagggcctgtccgcgcccaacggcccggcgcaggaacaggtgatccgccgcgcgctccgg
cagtccgggctcgacccggccgacatcgactacgtcgaggcccacggcaccggcaccacc
ctgggcgacccgatcgaggccaacgccctggccgaggtcttcgccggcacccgcccccag
gaccgcccgctgtacctgggctccctcaagtccaacatcggccatgtgcaggcggcttcg
ggcgtcgcgggactgatcaaggtcgtgcagtcgctgcggcacgggaccctgccgcccacc
ctgcacgccggcaccccgagccggcacgtcgagtgggacggcagcggcctcgcgctgctc
caggagccggtcgcctggccggcgacgggggagcgggtgcgccgggccgggatcagcgcg
ttcggcatcagcgggaccaacgcccacgtcgtcgtggaggaggccccggccaggcccggg
gagagggcccaggtgcgcgaactccccgacggcaaacagctgttcgtgctgtcggcgcgc
agcgaggcagggctgcgcggacaggcgtcccggctcgcccggcacctcaccacgggcacc
gggccgtcggacgtcgcccgcaccggcctgccggacgtcgcccgcaccctggccacgcac
cgcagccacttcgagtggcgcacggcggtcgtcgccggcgaccgggaggaactgctcacc
gcgctgaagccgctcgacccctcgaccggcgggcgcaaacccctgaccgctccccgcgag
gaccagaccggcaaggtcgccttcgtcttcgccgggcacggcggccagtggaccggcatg
ggactggaactgctcgcccagtcggaggcgttccgcgcggaactgacccggatagacgcc
gcagtcgaacggcacgccggctggtcggtgctcaacgtgctgcgcgcgcccgaggagttc
tccccgctcgaccgcaccgagtacctccagcccgtgctgttcgccgtcaacgcggcactg
gccgccgcctggcgggagctcggcgtcaccccggacgccgtcgtcgggcacagcctcggc
gagatcgccgccgcgtactgcgcgggcgccctcaccctggacgaggccgtgaccgccgtc
accgcccgggccgcggccgtagtcccgctggtcgggcacggcgggatgctggccgtggaa
ctgccggccgccgaggtcgagaagctgctggagccctacaccggccgcctgttcaccgcg
gccgtcaacagccccggcgccaccgccgtctccggcgaggccgaggcgctcgccgcgctc
cgccgcgaactggacgaacgcggcgtccccgcccgcgtcctgtcgacgccgttcgcctcg
cacacaccgctcatggagccgctgcgcgacgaactcctcgaccggttctccggcatcggc
ggcacccgtacggccaccacgctctactcgtcggtgcgggccgaaccggtcgacggcgcc
gacctggacgccgactactggttcgcgaacctgcgccgcccggtgcgtttcgcggagacc
gtcgcccggatgctggacgacggctaccgctacttcgtggaactcagcccgcacccctcg
ctcacctcggcgatcgaggcggtcgccgccgagagcgggaccgacgcggtcggcatcggc
tcgctgcgccgcggccgggacgggcacgacgtcctgctgggcaggctgggggagctgtac
acggccgggcacacccccgactggaccgcgctcttcccgcacgggcgccgcgccgacctg
cccacctacgccttcgcccgcgaacgccactggctcgcccccgtgcggaccggcgccacc
ggcatcccgccgctgctcggcacccacgtccaggccagcgacgaacccggccgcgacctc
ttccagagcgagatcgacctggccgacagccgcttcgcctacctgagcgaccaccgggtc
accggcgaggtgtggctgccgggcgccgccttcctcgacatggtgctggaggccgccgcc
tcgctctccggcggcgcggagacacggctggccgacgtccggttcctccagccactgcgc
ctggacgcgggcggccccgtacggctgcaactggtgctgcggcccgccgaggacggctcc
cgcgacttctccgtcgcctcggccgccggtgagcgccggtgggaacgccacgtgaccgga
cgtctgctgaccggccccgccgaacccgcccccggcccggacccggacctggccgccctg
cgtgcccggtgcaccgagccggtcgacctgcccgccgtctacgccggcctcgccgccctc
ggcatcgagtacggccccgccttccggggcctgaccgacggtcaccgcgacggaggcggc
gcggccctggcccgtctcgcggcccggccggccgccggtcatctgctgcaccccgccacg
ctggacgccgccttccacaccgccgcgctgcccgccaccgcgccgcagggccgggcgttc
gtaccggccggcgccggacacctgcggttcaccggaacgcgcagcacacccgcctgggcc
gcctgcgacctgcgtgccgtggacggcgacaccgccgtcctcgacctgcgcctgtgggac
gaggacggccggctcgtgctggcggccgacgacttccggctcaccgcgctctccccgctg
gacggcgccctcttcgagacacggtggcagccccgccccgaggcgcaggcgccgcccgcc
gacggcggctggctgatcctcgccgacggcacgggcgtggccgacgaactcgcccggcgg
ctcggcgactcggtcccgcacgccgtcgtccgccagggcaccgcgtacggcaccgacggc
cccggccgccacgtcctcgacccggccgacccggcccagtgggcacgcctgctggacgag
gcgttcgcggacgcgccgcccgcgcgcgtggtccagctcaccgcgctcgacgccccgccc
gtcaccgacgcccgcgccgccgaggaagcagcccggcactgctgcctcaccaccctgcac
ctggtccgcgccctcaccgggcaccggcggccgaacgccccggcaccgcgcctgttcgtc
gtcgtacgcggtagccagcccgcgggcgacagcaccgaggtgacccgccccgagcaggca
ctcgcgtggggtttcggactcaccgtcgcccaggagcacccggaactcgccaccacggtg
atcgacctgcccgccgaaggcggcgacgaccggctgtggacacagctcaggcacgccgac
gacgaacgcctcgtcgccctgcgcggcagcggccgcctcgtcccgcggctggcccgcacc
cggcccgaccacgacggcgccgaccccgggcagccggacggcgtgcacctgatcaccggc
ggtctgggcggcctcggccgggtcgtcgccgaacggctggtacgccagggcgcacgccgc
ctcgccctgctgagccgcgggacgcccgacgcggcggccaccgccttcgtccgtgacctg
gaggagcgcggggtcgacgtgcacctcgcccgcgccgacgtcgccgaccgcgccgcgctc
gccgccgccctggacgccgtgcgcgccgccgccggacccgtcgtcaccgtggtccacgct
gcgggtgtgctggacgacgccgtcctggccaacctcaccgaggaacgcgtccggcgcgtc
ctcgcgcccaaggtcctcggcaccgccctgctcaccgaactggtcccggaggcccggaac
ctggtcctgttcgcctcggccgccggtctgctgggctcgccgggccagggcccctactcc
gccgccaacgccttcctcgacgcgtgggcccaccacctctccctgaccggccgccgggca
ctcagcctggactggggcgcctggtcgggcgtcggcatggtcgccggttccggcacccgc
gccgccgagaccggccgctccggactcgtcgcgttcccgccgcaggacggcggcgagctg
ttcgaacgggtgctggcctcgggccgccgccagctcgccccgatcgccctcgactgggac
ctgctcgccctcgacccggacgcggcacgcggccgccccctgctcgccgacctgatcacc
gtcccggccggcggcgcggacaccgacgacctcgtacgacgggtgttcggcgccaccacc
gcgcaggagcgcgccgagtggctggagacctacgtacgcgaccgcgtcggcgaggtgtcc
ggcggcgccgtggacgtgttcgccaccaccgccctgaaggaactgggcctggactcgctc
atgctggtccggctgcgcaacgccttcgcgcgcgaactgggcgtcgaactgcccgccgcc
gacatgttctccgccaccgacatccgcggcctcgcgggcaccctggccgccgctctcccc
gagcgcgccgcaccggccggggggaccgcaccggccgggcggaccggcggcgccggagcc
gggcaggacgtcccggagaccgaactgcgcccggccacccgggacgtcgtacggctgctg
cgcagcgcccagccggacatgcccgacgccgcccacggcgtcggcctggccgtccggctc
accacgccggccacccgcgacggtctcaccggcatcctcgaccggctcgccgcccggcac
gcggccctgcgcacggccgtcgtcaccggcgacgagggcggccggcagctccgggtcgac
cggcggccgcccgccccgctgctgcgctggaccgaggccgccgaggcggacgccgccgaa
cggctgcggctgctgctggaacccccgttcgacctcgccgtcgcgccgctgtggcggttc
gaactcgtcgacggcgacccgcgcggccagatcctcgtcttcggcgcccaccacgccgtc
agcgatctgcagtccctgctcctcgtggccgcggagatcgacgccgaactgtcgggcacc
ccgctcgacgccactgtcaccaaccgggacatcgacctgctcatcgaggcacagcggggc
ggcggcaccggtcccggcgacgactggcgcgcggccttcgagggcagcgagcgcctcgac
ctgaccctcgcccacccgcggccgcccgtccgctcctaccggtccggaagcgtcaccgtc
accctccccgaggggctgaccgaacgggtgacggccgcagcgggcgccctcggcgtcacc
cccgccgcgttctgcctcggcaccctcaccgtgctgctggcccgggagcgggagcgggag
cggttcgtgctcgcggtgcccgtcgacacccgcatccacgccgacgcgtacggcgcggtg
ggcttcttcggcgtccccgtgcccttccccgcccaggcggccgcccacgaacgggtcgcg
gacgtgctcacccgcaccgaccagcggctgcgccagatcctggccaagggcgccatgttc
tccgacgtcctcgccacgctcgcccgccagggcctgcaccgccccgctgcgccgctcgtc
gaggtgtacttcaactacgtccgcttctccggcgagttgaagcacctggaggtgctgccc
gccggggtcgggcacaccgacctcgacctgatggtcaccatgaccccggacgccgggacc
gtccgcctcgaccacaacaccgacatcctggacgcggacaccgccaccgcgctcggcgag
gagttcctgcgcctgctggcgcggacggccgaggacgcgacggcaccggtgcgcaccgcg
ccgccggtttccgccgaggaaccggcggagtccgtgagcacggccctgacggttcccgtc
gaggaacccgcgcggtccgcgagcgccgccccgccggcccccgtcgagggaccccgggtc
gccctcgccgccaccttcgccctcggcaacctgccgctgatgtgcggggcggcgctggag
gacgagcgggccaccgtgaccgaggccccctaccaccaggtgctggccgccctccgggac
ccgtccggcgtcctcgccgacccggccaccgacgtccgcgtcgtcctgctgcgcgccgcc
gacctggaacggttcggacccgtggacgacacggtcctcgccgaactgcgcgccgcctac
ccggccgctctgaaggccctcgccgagcgcacccgcgggccgctcgtggtcggtgtcctg
ccgaccgcccggggcaccgaccgctgccacgcgtgggaacgcgccgtcgccgccgacctg
accggactgcccggcatcgccgtgctcggccccgacgagtggacccggtaccacagcgtc
gacaaccgcttcgacgaacgcaccgagcggctggcccacctgcccttcacccccgagttc
caggcggccgtcgcgctgcgtctggccgagacggtacgggcggtacggcgtcccgtgccc
aaggtgatcgccgtcgacggcgacgagaccctgtggggcggagtggccggcgagatcggc
ccggacgccgtggacctcaccgggccccgcgcctcgctggcccgcaggctgctgcggtgg
cgcaccgcgggcgtgctgctcgcgctggtcagcaacaacgacgaggccacggtgcgggcc
gtcctcgaccgccccgacagcctgctgaaggccgagcacttcagcgtgatctccgccgcc
tggggccccaagccgggccggctcgccgacgcggcacggacgctcgacctgggcctggac
agcttcctgttcctcgacgacaacccggccgagatcgccaggatgcgcgcggcgctcccg
caggtgctgtccgtgacctgcccgccggccggcggactcgacgcgttcctggaccggctg
tggccgctcgtcccggccgcggcgaccgccgaggacgccctgcgggcccggttctacgcc
caggagcgcgagcgggacgccgtccgggagtccgccgggttcgaggagttcctcgccgac
ctcgacctggtggtcgacatccgcgagctgtcggacgcggacgccgagcgtggtgagcaa
ctggtgcgccgcacgaaccagttcaccctgcgcgcgcggtccgcggacggcggcgacctc
gcccggtggcgcgagcggggcgaggtgtggacggcgtcggcccgggaccggttcggcgac
tacggccagatcgcgctgctcgccttcggtgccgacggcgaccggctcgacgtccacgcc
tggctgatgagctgccgggccctcggccggggcgtcgaggaacgcctgctggcctggctc
gccgaccgggccgagcggctgggccgcaccgaggtccggatcgtcgccgagcgcaccccg
cgcaacgcgcccgcgcgccgcctgctggccgcgctcggcggcggcgacccggacggcgag
cggctggaggtcgtggccggccccgagcgactgcgggcgttccgctcctgggagcagccg
tga

DBGET integrated database retrieval system