KEGG   Streptomyces collinus: B446_11430Help
Entry
B446_11430        CDS       T02787                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sci  Streptomyces collinus
Pathway
sci00020  Citrate cycle (TCA cycle)
sci00310  Lysine degradation
sci00380  Tryptophan metabolism
sci01100  Metabolic pathways
sci01110  Biosynthesis of secondary metabolites
sci01120  Microbial metabolism in diverse environments
sci01130  Biosynthesis of antibiotics
sci01200  Carbon metabolism
Module
sci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B446_11430
  09105 Amino acid metabolism
   00310 Lysine degradation
    B446_11430
   00380 Tryptophan metabolism
    B446_11430
Enzymes [BR:sci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B446_11430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AGS69108
UniProt: S5UPX3
LinkDB All DBs
Position
2655226..2657019
Genome map
AA seq 597 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPSPAAGVLASIK
VAEDETVEVGAELAVIDDGTGAPAAAPAPAAAEAPAPAAPAAPAAEAAPAPAPAPEAPAA
PAAPAGGAEGTDVVLPALGESVTEGTVTRWLKSVGDSVEADEPLLEVSTDKVDTEIPAPT
SGVLLEIVVGEDETAEVGAKLAVIGAPGAAPAAAPAPAAPAPAAAPAPAAAPAPAAAPAP
APAAPAAPAPAPAPVAAAPAPAAPAPAPAPVTPAAAPTSPTATQATDEGAYVTPLVRKLA
AENGVDLAAVKGTGVGGRIRKQDVLAAAEAAKAAAAPAPSAAAAPAARKAAPALEVSSLR
GQTVKMPRIRKVIGDNMVKALHEQAQLSSVVEVDVTRLMRLRAQAKDSFAAREGVKLSPM
PFFVKAAAQALKAHAVVNAKINEAEGTITYFDTENVGIAVDSEKGLMTPVIKHAGDLNIA
GIAKATAELAGKVRANKITPDELSGATFTISNTGSRGALFDTIIVPPGQVAILGIGATVK
RPAVIETEEGTVIGVRDMTYLTLSYDHRLVDGADAARYLTAVKAILEAGEFEVELGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaacccttccggcgctcggcgagagcgtcaccgagggcactgtcacc
cgctggctgaaggccgagggcgagcgcgtcgaggccgacgagccgctgctcgaggtctcg
accgacaaggtcgacaccgagatcccctcgcccgccgccggtgtgctggcctccatcaag
gtcgccgaggacgagaccgtcgaggtcggcgccgagctggccgtgatcgacgacggcacg
ggcgcgcccgctgccgctccggcccccgccgccgccgaggccccggctccggccgccccg
gccgccccggcggccgaggccgcccccgccccggctccggcgccggaggcacccgccgcg
ccggccgccccggccggtggcgccgagggcacggacgtggtcctgcccgcgctcggtgag
tccgtcaccgagggcaccgtcacccgctggctgaagtcggtcggcgactccgtcgaggcc
gacgagccgctgctcgaggtctccacggacaaggtcgacaccgagatcccggcgcccacc
tccggtgtgctgctcgagatcgtggtgggcgaggacgagaccgccgaggtcggtgccaag
ctcgccgtcatcggcgcccccggtgccgccccggccgccgctccggctccggccgccccg
gcccccgccgccgccccggcccccgccgccgccccggcccccgccgccgctccggctccg
gctcccgccgcgcctgccgctccggccccggctccggcccccgtggccgccgccccggcc
ccggccgctccggcgcccgccccggctccggtcaccccggcggccgcgcccacctcgccg
accgccacccaggcgaccgacgagggcgcctacgtgaccccgctggtgcgcaagctcgcc
gccgagaacggcgtcgacctggccgccgtcaagggcaccggcgtcggcggccgtatccgc
aagcaggacgtcctcgcggccgccgaggccgcgaaggccgccgcggccccggctccgtcc
gctgccgccgccccggccgccaggaaggcggcgcccgcgctggaggtctcctcgctgcgc
ggccagaccgtgaagatgccgcggatccgcaaggtcatcggcgacaacatggtcaaggcg
ctgcacgagcaggcccagctgtcgtcggtcgtcgaggtggacgtcacgcgtctgatgcgc
ctgcgcgcccaggccaaggactccttcgccgcgcgcgagggcgtcaagctctccccgatg
ccgttcttcgtgaaggcggcggcccaggcgctgaaggcccacgcggtcgtcaacgccaag
atcaacgaggccgagggcacgatcacctacttcgacaccgagaacgtcggtatcgcggtg
gactccgagaagggcctgatgaccccggtcatcaagcacgccggcgacctcaacatcgcg
ggcatcgccaaggccacggcggagctggccggcaaggtccgcgccaacaagatcaccccg
gacgagctgtccggcgcgaccttcaccatctccaacaccggttcgcgcggcgcgctgttc
gacacgatcatcgtgccgccgggccaggtcgcgatcctcggcatcggtgccacggtcaag
cgtccggccgtcatcgagaccgaggagggcacggtcatcggcgtccgcgacatgacctac
ctgacgctctcctacgaccaccgcctggtcgacggcgccgacgcggcccgttacctgacg
gccgtcaaggcgatcctggaggcgggcgagttcgaggtcgagctgggcctctga

DBGET integrated database retrieval system