KEGG   Streptomyces collinus: B446_12175Help
Entry
B446_12175        CDS       T02787                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
sci  Streptomyces collinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AGS69257
UniProt: S5VFB7
LinkDB All DBs
Position
complement(2817552..2819003)
Genome map
AA seq 483 aa AA seqDB search
MAELVEHGQLYIGGELADPVGKDVIEVVSPHTEEVIGRVPHASREDVDRAVAVARRAFDE
GDWPRASLEERTGVVTRIKDGIAARHEEIARMISSENGSPYSWSVLAQALGAMMVWDSAI
KVARDFPYEERRDGVLGPILVRREPVGVVAAVVPWNVPQFVAAAKLAPALLAGCSVVLKP
SPESPLDAYLLGEIAREAGLPEGVLSILPADREVSEYLVGHPGIDKVSFTGSVAAGRRVM
EVAARNLTRVTLELGGKSAAVVLPDADLGAAVSGIVPAAWMNNGQACVAQTRILVPRARY
DEFADAFAQAAGALEVGDPLDPATRVGPLVARRQQRRNLDYIRIGQEEGAKILTGGGRPP
GLDKGWYVEPTLFGDVHNSMRIAREEIFGPVVCLLPYGDETEAVKIANDSEYGLSGSVWT
ADVGHGVEIARQVRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEYLEHKMIHLP
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctcgtggagcacggacagctgtacatcggcggggagttggccgatcccgtc
ggcaaggacgtcatcgaggtggtctcgccgcacaccgaggaggtcatcggccgggtgccg
cacgcctcgcgcgaggacgtcgaccgcgccgttgccgtcgcccgccgcgccttcgacgag
ggggactggccgcgtgcctcactggaggagcggaccggggtcgtcacccggatcaaggac
gggatcgccgcccggcacgaggagatcgcccggatgatctcctcggagaacggctccccg
tactcatggagcgtcctcgcccaggcgctcggcgcgatgatggtgtgggactcggcgatc
aaggtcgcgcgggacttcccgtacgaggagcgccgcgacggcgtgctcggcccgatcctc
gtgcggcgcgagccggtcggcgtggtcgccgcagtcgtcccctggaacgtcccgcagttc
gtcgcggccgcgaaactcgcccccgcgctgctggccggctgctcggtcgtgctcaagccg
tccccggagtccccgctggacgcctatctcctcggcgagatcgcgcgcgaggccgggctg
ccggagggcgtcctgtcgatcctgcccgccgaccgcgaggtcagcgagtacctggtcggc
caccccggcatcgacaaggtctccttcaccgggtcggtcgcggcgggccgccgggtgatg
gaggtggccgcccgcaacctcacccgggtcaccctggagctgggcggcaagtcggcggcg
gtcgtgctgcccgacgccgacctcggggcggccgtctcggggatcgtccccgcggcctgg
atgaacaacgggcaggcgtgcgtggcccagacccggatcctcgtcccccgggcccgctac
gacgagttcgcggacgccttcgcgcaggccgcgggcgcgctcgaggtcggcgacccgctg
gacccggccacccgggtcggcccgctggtggcccggcggcagcagcgccgcaacctcgac
tacatccgcatcggccaggaggagggcgccaagatcctcaccggcggcggccgcccgccg
ggcctggacaagggctggtacgtagagcccaccctcttcggcgacgtccacaactccatg
cggatcgcccgtgaggagatcttcggcccggtcgtctgcctgctcccgtacggcgacgag
accgaggccgtgaagatcgccaacgactccgagtacggcctgtccgggagtgtgtggacg
gccgacgtcgggcacggcgtcgagatcgcccgccaggtgcgcaccggcacctactccgtc
aacaccttcagcctcgacatgctgggcccgttcggcggctacaagaactccggcctgggc
cgggagttcggccccgaggggtacggcgagtacctggagcacaagatgatccacctgccg
gcgggagcctag

DBGET integrated database retrieval system