KEGG   Streptomyces collinus: B446_12575Help
Entry
B446_12575        CDS       T02787                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sci  Streptomyces collinus
Pathway
sci00010  Glycolysis / Gluconeogenesis
sci00052  Galactose metabolism
sci01100  Metabolic pathways
sci01110  Biosynthesis of secondary metabolites
sci01120  Microbial metabolism in diverse environments
sci01130  Biosynthesis of antibiotics
Module
sci_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B446_12575
   00052 Galactose metabolism
    B446_12575
Enzymes [BR:sci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     B446_12575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: AGS69335
UniProt: S5VLR9
LinkDB All DBs
Position
2901516..2902670
Genome map
AA seq 384 aa AA seqDB search
MELNRRTVIAGAAAAGLAATTLGPGTAQAAVPGGKPVKHLFGRLADGTKVYRWSLANGGT
RLKVLSYGGIVQSLEVPDRHGRHANVVAGFAGLDDYVASSPYFGALIGRYGNRIGKGRFT
LDGTAYQLSVNDGENSLHGGAKGFDKHVWDVEPFTRGSDVGLRLYYTSVDGEMGYPGTLR
SKVTYTLDRHGAWRIDYEATTNRATVVNLTSHVYWNLAGEGSGTIEDHELTIAASRYTPT
DAGLIPTGELARVGGTPFDFRRAKPIGRDIRAGHVQQVQAKGYDHNWALDKGITAGPKHV
ATLRDPRSGRTLAIATDQPGLQFYSGNFLDGTLTGTGGRTYRQGDALCLETQHFPDSPNH
ANFPSTVLRPGQTYRTSTVHTFGT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtggaactgaacagacgtacggtcatcgcgggagcagcggcggcgggcctggccgccacc
accctcggcccgggcaccgcccaggccgccgtcccgggcgggaaaccggtgaagcacctc
ttcggcaggctcgccgacggcaccaaggtgtaccgctggtcgctggcgaacggcggcacc
cggctgaaggtgctgtcctacggcggcatcgtgcagagcctggaggtccccgaccggcac
ggccggcacgcgaacgtcgtcgccgggttcgccggcctcgacgactacgtggcgagcagc
ccgtacttcggcgccctgatcgggcggtacggcaaccgcatcggcaagggccggttcacc
ctcgacggcaccgcctaccagctgtccgtcaacgacggcgagaacagcctgcacggcggc
gccaagggcttcgacaagcacgtgtgggacgtcgagccgttcacccggggctccgacgtc
gggctgcgcctgtactacaccagcgtcgacggggagatgggctacccgggcaccctgcgg
tcgaaggtgacgtacaccctcgaccggcacggcgcctggcgcatcgactacgaggccacc
accaaccgggcgaccgtcgtcaacctcaccagccacgtctactggaacctggcgggcgag
ggcagcggcacgatcgaggaccacgagctcacgatcgccgcctcccgctacacgcccacc
gacgcgggcctgatccccaccggtgaactggcccgggtcggcggcaccccgttcgacttc
cgccgcgccaagcccatcggccgggacatccgggccggccacgtccagcaggtgcaggcc
aagggctacgaccacaactgggcgctggacaagggcatcacggcggggcccaagcacgtg
gccaccctgcgcgacccgcgctccgggcgcaccctggccatcgccaccgaccagccgggc
ctgcagttctactcgggcaacttcctcgacggcaccctgaccggcaccggcggccgcacc
taccgccagggcgacgccctgtgcctggagacgcagcacttcccggactcgccgaaccac
gcgaacttcccgtcgacggtgctgcggccggggcagacgtaccggacgagcacggtgcac
acgttcggcacgtga

DBGET integrated database retrieval system