KEGG   Streptomyces collinus: B446_16225Help
Entry
B446_16225        CDS       T02787                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sci  Streptomyces collinus
Pathway
sci00620  Pyruvate metabolism
sci00680  Methane metabolism
sci01100  Metabolic pathways
sci01120  Microbial metabolism in diverse environments
sci01200  Carbon metabolism
Module
sci_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B446_16225
  09102 Energy metabolism
   00680 Methane metabolism
    B446_16225
Enzymes [BR:sci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B446_16225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGS70063
UniProt: S5USG2
LinkDB All DBs
Position
complement(3761102..3763834)
Genome map
AA seq 910 aa AA seqDB search
MSSADDQATTTSTELRADIRRLGDLLGETLVRQEGPELLDLVEKVRRLTREDGEAAAELL
RGTELDTAAKLVRAFSTYFHLANVTEQVHRGRELRARRAAEGGLLARTADRLKDADPEHL
RQTVEHLNVRPVFTAHPTEAARRSVLNKLRRVAALLDTPVLDSDRRRHDVRLAENIDLVW
QTDELRVVRPEPADEARNAIYYLDELHADAVGDVLEDLTAELERVGVKLPDHARPLTFGT
WIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGLLSNSIRYTGATQELLDSL
DTDLERLPEISPRYKRLNAEEPYRLKATCIRQKLENTKQRLAKGSAHEDGRDYLGTGELL
TDLRIIQASLREHRGALFADGRLNRTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRL
GEESWRYADMPRDYRAKLLAKELRSRRPLAPTPAPVDAAGQKTLGVFETVKKALAVFGPE
VIESYIISMCQGADDVFAAAVLAREAGLLDLHAGWAKIGIVPLLETTDELRAADTILEDM
LSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLF
HGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAAT
LQASALHTAPRQSDEALARWDAAMDVVSDAAHAAYRRLVEDPDLPTYFLASTPVDQLAEL
HLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALRETGLDTVLGEM
HEQWHFFRNFISNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDTIRAEHELTVSEVLKVT
GEQELLDAQPVLRQTFSIRDAYLDPISYLQVALLKRQRDEAAAGATPDPLLSRALLLTVN
GVAAGLRNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccaggccaccacgaccagcaccgagctgcgcgccgacatcagg
cggctgggcgacctcctgggcgagaccctcgtacgccaggaaggccccgaactcctcgac
ctggtcgagaaggtccgccgcctcacccgcgaggacggcgaggccgccgccgagctgctg
cgcggcaccgaactcgacaccgcggccaagctggtccgcgccttctccacctacttccac
ctggccaacgtcaccgaacaggtgcaccgcggccgcgaactgcgcgcccggcgcgccgcc
gagggcggcctcctcgcccgcaccgccgaccgcctcaaggacgccgaccccgagcacctg
cggcagaccgtcgagcacctcaacgtgcgccccgtcttcaccgcccaccccaccgaggcc
gcacgccgctccgtcctcaacaagctccgccgcgtcgccgccctcctggacacccccgtc
ctcgactccgaccgccgccgccacgacgtccgcctcgccgagaacatcgacctcgtctgg
cagaccgacgaactccgcgtcgtgcgccccgagcccgccgacgaggcccgcaacgccatc
tactacctcgacgaactccacgccgacgccgtcggcgacgtcctcgaggacctcaccgcc
gaactcgaacgcgtcggggtcaagctccccgaccacgcccgccccctcaccttcggcacc
tggatcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtcacctgggacgtc
ctcatcctccagcacgaacacggcatcaacgacgccctggagatgatcgacgaactgcgc
ggactgctctccaactccatccgctacaccggcgccacccaggaactgctcgactccctc
gacaccgacctcgagcggctccccgagatcagcccccgctacaagcgcctcaacgccgag
gagccctaccggctcaaggccacctgcatccgccagaagctggagaacaccaagcagcgc
ctcgccaagggcagcgcccacgaggacggccgcgactacctcggcaccggcgaactcctc
accgacctgcggatcatccaggcatccctgcgcgaacaccgaggcgccctcttcgccgac
ggccgcctcaaccgcaccatccgcaccctcgccgccttcggcctccagctcgccaccatg
gacgtccgcgaacacgccgacgcccaccaccacgccctcggccagctcttcgaccgcctc
ggcgaggagtcctggcgctacgccgacatgccccgcgactaccgcgccaagctcctcgcc
aaggaactgcgctcccgccggcccctcgcccccacccccgcccccgtcgacgcggccggg
cagaagaccctcggcgtcttcgagaccgtcaagaaggccctcgcggtcttcggccccgag
gtcatcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgccgcc
gtcctcgcccgcgaggccggcctcctcgacctccacgccggctgggccaagatcggcatc
gtgcccctcctggagaccaccgacgagctgcgcgccgccgacaccatcctcgaggacatg
ctctccgacccgtcctaccggcgcctcgtcgcgctgcgcggcgacgtccaggaggtcatg
ctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgggagatccac
cgcgcccagcgccggctgcgcgacgtcgcccaccgctacggcgtacgcctgcgcctcttc
cacggccgcggcggcaccgtcggccgcggcggcggcccctcgcacgacgcgatcctcgcc
cagccctggggcaccctggagggcgagatcaaggtgaccgagcagggcgaggtcatctcc
gacaagtacctgatcccctccctcgcccgggagaacctggagctgacggtcgccgccacc
ctccaggcgtccgccctgcacaccgcgccccgccagtccgacgaggccctcgcccgctgg
gacgcggccatggacgtcgtctccgacgccgcccacgccgcctaccgccggctcgtcgag
gaccccgacctgccgacgtacttcctcgcctccacccccgtcgaccagctcgccgagctg
cacctgggctcgcggccctcccgccgccccggctccggcgtctcgctcgacggcctgcgc
gccatcccctgggtgttcggctggacccagtcccggcagatcgtgcccggctggttcggc
gtcggctccggcctcaaggcgctgcgggagaccggcctggacaccgtgctcggcgagatg
cacgaacagtggcacttcttccgcaacttcatctccaacgtcgagatgaccctcgccaag
accgacctgcgcatcgcccagcactacgtcgacaccctcgtccccgacgagctcaagcac
gtcttcgacaccatcagggccgaacacgagctgaccgtcagcgaggtcctcaaggtcacc
ggcgaacaggaactcctcgacgcccagcccgtcctcaggcagaccttcagcatccgcgac
gcctacctggacccgatctcctacctccaggtcgccctgctcaagcgccagcgcgacgag
gccgccgccggcgccacccccgacccgctgctctcccgcgccctgctcctcaccgtcaac
ggcgtggccgccggcctgcgcaacaccggctga

DBGET integrated database retrieval system