KEGG   Streptomyces collinus: B446_17190Help
Entry
B446_17190        CDS       T02787                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sci  Streptomyces collinus
Pathway
sci00071  Fatty acid degradation
sci00280  Valine, leucine and isoleucine degradation
sci00281  Geraniol degradation
sci00310  Lysine degradation
sci00360  Phenylalanine metabolism
sci00362  Benzoate degradation
sci00380  Tryptophan metabolism
sci00410  beta-Alanine metabolism
sci00627  Aminobenzoate degradation
sci00640  Propanoate metabolism
sci00650  Butanoate metabolism
sci00903  Limonene and pinene degradation
sci00930  Caprolactam degradation
sci01100  Metabolic pathways
sci01110  Biosynthesis of secondary metabolites
sci01120  Microbial metabolism in diverse environments
sci01130  Biosynthesis of antibiotics
sci01212  Fatty acid metabolism
Module
sci_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B446_17190
   00650 Butanoate metabolism
    B446_17190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B446_17190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B446_17190
   00310 Lysine degradation
    B446_17190
   00360 Phenylalanine metabolism
    B446_17190
   00380 Tryptophan metabolism
    B446_17190
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B446_17190
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B446_17190
   00281 Geraniol degradation
    B446_17190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B446_17190
   00627 Aminobenzoate degradation
    B446_17190
   00930 Caprolactam degradation
    B446_17190
Enzymes [BR:sci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B446_17190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGS70254
UniProt: S5V547
LinkDB All DBs
Position
complement(3970819..3971556)
Genome map
AA seq 245 aa AA seqDB search
MTALVGRTRARGVETLSLDSTATRNALSAALVTELDGALTDCGKDPDVRAVVLTHTGTTF
CAGADLRDPPDPDALVGLLRRIVELPTPVLARITGHVRAGGFGLLAACDMAAAGPEATFA
FTEVRIGVAPAVISLPVLPRTDPRALARYYLTGERFTPADAVRLGLLTVTADDVDDALAP
LLDGLRRSAPQALAETKRLLTARVLETFDRDAAELTALSARLFASAQAREGMTAFLERRD
AAWVV
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactcgtcggccgcacccgcgcgcgcggggtcgagaccctcagcctcgactcc
accgccacccgcaacgccctgtccgccgcgctcgtcaccgaactcgacggcgccctgacc
gactgcggcaaggaccccgacgtccgcgccgtcgtgctcacccacaccggcaccaccttc
tgcgccggggccgacctgcgcgacccgcccgaccccgacgccctcgtcgggctgctgcgc
cggatcgtcgaactgcccacgcccgtcctcgcccggatcaccggacacgtccgcgccggc
ggcttcggcctgctcgccgcctgcgacatggccgccgcgggccccgaggccaccttcgcc
ttcaccgaggtccgcatcggcgtcgcccccgcggtcatctccctgccggtcctgccgcgc
accgacccgcgcgccctcgcccgctactacctcaccggtgaacgcttcacccccgccgac
gccgtacgcctgggcctgctcaccgtcaccgccgacgacgtcgacgacgccctcgccccc
ctcctcgacggcctgcgccgctccgccccgcaggccctggccgagacgaaacggctgctc
acggctagggtgctggagacgttcgaccgggacgcggcggaactgaccgcgctctcggcc
cggctgttcgcctccgcccaggcccgggaggggatgacggccttcctggaaagacgggat
gcggcatgggtggtgtga

DBGET integrated database retrieval system