KEGG   Streptomyces collinus: B446_22400Help
Entry
B446_22400        CDS       T02787                                 

Definition
(GenBank) glycerol phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sci  Streptomyces collinus
Pathway
sci00564  Glycerophospholipid metabolism
sci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B446_22400
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B446_22400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 DUF5069
Motif
Other DBs
NCBI-ProteinID: AGS71292
UniProt: S5VL43
LinkDB All DBs
Position
5141355..5143064
Genome map
AA seq 569 aa AA seqDB search
MRTATLGPAQRAEALAAMAERELDVLVVGGGVVGAGTALDAVTRGLSTGIVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERWY
AGSGVALYDAMSMARGHGRGLPVHRHLTRRHALSVAPCLKKDALVGALQYYDAQMDDARY
VATLVRTAVSYGAHAANRARVTGFLREGERVVGARVQDVEGGGEYEIRAKQIVNATGVWT
DDTQAMVGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TEWDLDKAHPAASSADIDYLLEHVNSVLAVPLSRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDMRVADCVTEDIPLLGAEGYQAM
WNARARTAARTGLHVVRVEHLLNRYGSMAEEVLDLITADPALGEPLHAADDYLRAEVVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSAREAAELMAPVLGWDKDQIEREVEHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPLQ
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgactctgggcccggcacagcgcgccgaggcactggcggccatggcggag
cgcgaactggacgtgctggtggtcggcggcggagtggtcggcgccggtaccgcgctggac
gccgtcacccgtggcctgtccaccgggatcgtcgaggcgcgcgactgggcctccggcacc
tccagcaggtccagcaagctcatccacggtggtctgcgctatctggagatgctcgacttc
gcgctggtccgcgaggcgttgaaggagcgcggcctgctcctggagcggctcgccccgcac
ctggtgaaacccgtgccgttcctctacccgctccagcacaagggctgggagcggtggtac
gcgggttcgggcgtggccctgtacgacgccatgtccatggcccgcgggcacggccgtggc
ctgcccgtgcaccggcacctgacccggcgtcacgccctcagcgtggcaccgtgcctgaag
aaggacgccctggtcggcgccctgcagtactacgacgcgcagatggacgacgcccggtac
gtggcgaccctggtgcgcaccgcggtgtcgtacggcgcccacgcggccaaccgcgcccgg
gtgaccgggttcctgcgcgagggcgagcgcgtcgtcggcgcccgggtgcaggacgtcgag
ggcggcggggagtacgagatccgggccaagcagatagtcaacgccaccggcgtgtggacc
gacgacacgcaggccatggtgggggagcgcggccagttccacgtccgcgcctccaagggc
atccacctggtcgtgcccaaggaccgcatccactccaccaccggcctgatcctgcgcacc
gagaagtcggtcctcttcgtcatcccctggggacggcactggatcgtcggcaccaccgac
accgaatgggacctcgacaaggcccatccggccgcctccagcgccgacatcgactacctg
ctggagcacgtgaactcggtgctcgccgtcccgctcagccgagacgacgtacagggcgtt
tacgcgggcctgcgcccgctgctggccggcgagtccgacgccaccagcaaactgtcccgc
gagcacaccgtggcgcatccggtgccgggcctcgtggtggtggcgggcggcaagtacacg
acgtaccgggtgatggcgaaggacgccgtggacgaggcggtgcacgggctcgacatgcgc
gtcgccgactgcgtcaccgaggacatcccgctgctcggcgcggaggggtaccaggcgatg
tggaacgcgcgggcgcggacggccgcccgcaccggactgcacgtggtgcgcgtggaacat
ctgctgaaccgatacggctccatggccgaggaggtcctggacctcatcaccgccgacccg
gccctcggcgaaccgctgcacgccgccgacgactacctgcgcgccgaggtcgtgtacgcg
gcctcgcacgagggcgcgcggcacctggacgacgtcctcacccgccgcacccgcatctcc
atcgagaccttcgaccggggcacccgcagtgcccgcgaggccgccgagctgatggcgccc
gtcctcggctgggacaaggaccagatcgagcgcgaggtggagcactacgagaagcgggtc
gaggcggagcgtgagtcccagcgccagccggacgacctgacggccgacgcggcccggctg
ggcgcgccggacatcgtgccgcttcagtga

DBGET integrated database retrieval system