KEGG   Streptomyces collinus: B446_22630Help
Entry
B446_22630        CDS       T02787                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sci  Streptomyces collinus
Pathway
sci00020  Citrate cycle (TCA cycle)
sci00270  Cysteine and methionine metabolism
sci00620  Pyruvate metabolism
sci00630  Glyoxylate and dicarboxylate metabolism
sci00680  Methane metabolism
sci01100  Metabolic pathways
sci01110  Biosynthesis of secondary metabolites
sci01120  Microbial metabolism in diverse environments
sci01130  Biosynthesis of antibiotics
sci01200  Carbon metabolism
Module
sci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sci_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B446_22630
   00620 Pyruvate metabolism
    B446_22630
   00630 Glyoxylate and dicarboxylate metabolism
    B446_22630
  09102 Energy metabolism
   00680 Methane metabolism
    B446_22630
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    B446_22630
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     B446_22630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AGS71338
UniProt: S5UVX6
LinkDB All DBs
Position
5201517..5202506
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEITPALKAAEGTAMELDD
CAFPLLQGIDITDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSTVADIK
RLTIWGNHSATQYPDIFHATVAGKNAAEVVNDEKWLAEDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTAEGDWTSMGIPSDGSYGVPEGLISSFPVTTKDGKYEIVQGLD
INEFSRARIDASVQELAEEREAVRSLGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctccggccagctgctcggcgcggacgtgccggtcaagctgcgc
ctcctggagatcaccccggcgctcaaggccgccgagggcaccgccatggagctggacgac
tgcgcgttcccgctgctccagggcatcgacatcacggacgacccgaacgtggccttcgac
ggcgccaacgtggccctcctcgtcggcgcccgcccccgcaccaagggcatggagcgcggt
gacctgctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgccgacgacatcaaggtcctcgtggtcggcaacccggccaacaccaacgcgctcatc
gcgcaggccgccgcgccggacgtgccggccgagcgcttcaccgcgatgacccgtctggac
cacaaccgcgcgctgacccagctcgcgaagaagaccggctcgacggtcgcggacatcaag
cgcctgaccatctggggcaaccactccgccacccagtacccggacatcttccacgccacg
gtcgccggcaagaacgccgccgaggtcgtgaacgacgagaagtggctggccgaggacttc
atcccgaccgtcgccaagcgcggtgccgcgatcatcgaggcccgtggcgcctcctccgcg
gcctccgccgccaacgccgccatcgaccacgtgcacacctgggtcaacggcaccgccgag
ggcgactggacctccatgggcatcccgtcggacggctcctacggcgtcccggagggcctg
atctcctccttcccggtcaccaccaaggacggcaagtacgagatcgtccagggcctggac
atcaacgagttctcccgcgcccgcatcgacgcctccgtccaggagctcgccgaggagcgc
gaggcggtccgttccctgggcctcatctga

DBGET integrated database retrieval system