KEGG   Streptomyces collinus: B446_24985Help
Entry
B446_24985        CDS       T02787                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sci  Streptomyces collinus
Pathway
sci03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sci00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    B446_24985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sci03400]
    B446_24985
Enzymes [BR:sci01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     B446_24985
DNA repair and recombination proteins [BR:sci03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     B446_24985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGS71808
UniProt: S5UX45
LinkDB All DBs
Position
complement(5739003..5739848)
Genome map
AA seq 281 aa AA seqDB search
MLSNLDKVLYPETGFTKGELVHYYATTAAVLLPHLRDRAMSFLRFPDGPDGQRFFAKNVP
PGTPEWVTTAEVPRSEGPARMVVVQDLASLVWAANLVTEFHTHQWLVQSPEEADRLVFDL
DPGAPATIVDCCEVALWLRERLAADGIEAYAKTAGSKGLHLLAAVRGASSERTSEYAKQL
AVEAERAMPRLVVHRMTKSLRPGKVFVDWSQNAARKTTAAPYTLRARPAPLVSAPVRWAE
VEECREPGTLEFLAGDVASRVQQHGDLLAPLLDAGRSVPLP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgctcagcaacctggacaaggtgctgtatccggagacgggcttcaccaagggcgagctg
gtgcactactacgcgaccaccgccgccgtgctgctgccgcacctgcgcgaccgcgcgatg
tccttcctgcgcttccccgacgggccggacgggcagcggttcttcgccaagaacgtgccg
ccgggtacgcccgagtgggtcacgaccgccgaggtcccccggtccgagggcccggcccgg
atggtggtcgtacaggatctggcgagcctggtctgggcggcgaacctggtgaccgagttc
cacacgcaccagtggctggtgcagtcgcccgaggaggccgaccggctggtgttcgacctg
gacccgggggcgcccgcgacgatcgtcgactgctgcgaggtcgccctgtggctgcgggag
cggctggccgcggacgggatcgaggcgtacgccaagacggccgggtccaaggggctgcac
ctgctggcggccgtgcgcggggcgtcgtccgagcggacgagcgagtacgcgaagcagctc
gcggtggaggccgagcgggcgatgccccggctcgtggtgcaccggatgacgaagagcctc
aggccggggaaggtgttcgtcgactggagccagaacgcggcgcgcaagacgacggcggcg
ccgtacacgctgcgggcccggccggccccgctggtgtcggctccggtgcggtgggcggag
gtcgaggagtgccgggagccggggacgctggagttcctggccggggacgtcgcgtcccgg
gtgcaacagcacggggatctgctggctccgctgctggacgccgggcggtcggtgccgctg
ccctga

DBGET integrated database retrieval system