KEGG   Streptomyces collinus: B446_29465Help
Entry
B446_29465        CDS       T02787                                 

Definition
(GenBank) class III aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sci  Streptomyces collinus
Pathway
sci00250  Alanine, aspartate and glutamate metabolism
sci00410  beta-Alanine metabolism
sci00640  Propanoate metabolism
sci00650  Butanoate metabolism
sci01100  Metabolic pathways
sci01120  Microbial metabolism in diverse environments
Module
sci_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B446_29465
   00650 Butanoate metabolism
    B446_29465
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B446_29465
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B446_29465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sci01007]
    B446_29465
Enzymes [BR:sci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B446_29465
Amino acid related enzymes [BR:sci01007]
 Aminotransferase (transaminase)
  Class III
   B446_29465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGS72699
UniProt: S5VC04
LinkDB All DBs
Position
6819032..6820315
Genome map
AA seq 427 aa AA seqDB search
MNDLYARHRNVLPDWLALYYDEPLEITHGEGRHVWDSAGNRYLDFFGGILTTMTAHALPE
VTKAVSEQAGRIIHSSTLYLNRPMVELAERIAQVSGIPDARVFFTTSGTEANDTALLLAT
AYRRSNTVLAMRNSYHGRSFSTVGITGNRSWSPTSLSPLQTLYVHGGVRHRGPFADLDDR
AFIDACVADLRDVLGHTRPPAALIAEPVQGVGGFTSPPDGLYAAFREVLNAHGILWISDE
VQTGWGRTGEHFWGWQAHARSGPPDIVTFAKGIGNGSSIGGVIARAEIMNCLDANSISTF
GGTQLTMAAGLANLTYLLEHDLQGNARRVGGLLIERLRAVAAQLPGVREVRGRGLMIGVE
LVRPGTDEADPRAAAAVLEAAREGGLLIGKGGGHDTSALRIAPPLSLTVAEAEEGAAILE
SALRSTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacctctacgcccgccaccgcaacgtcctgccggactggctcgccctctactac
gacgagccgctggagatcacgcacggcgagggccgccacgtctgggactccgcgggcaac
aggtacctggacttcttcggcggcatcctcaccaccatgaccgcgcacgcccttcccgag
gtgaccaaggcggtcagcgagcaggccggccggatcatccactcctcgacgctctacctc
aaccggccgatggtcgaactcgccgagcgcatcgcccaggtgagcggcatcccggacgcc
cgggtcttcttcacgacctccggcaccgaggccaacgacaccgccctgctgctcgccacc
gcctaccggcgcagcaacacggtcctggcgatgcgcaacagctaccacggccgctccttc
agcaccgtcggcatcaccggcaaccgcagctggtccccgacctcgctgtccccgctgcag
accctctacgtgcacggcggcgtccgccaccggggccccttcgccgacctcgacgaccgc
gccttcatcgacgcctgcgtggcggacctccgggacgtcctcgggcacacccgcccgccg
gccgcgctgatcgccgaacccgtccagggcgtcggcggcttcacctcgcccccggacggc
ctctacgccgccttccgtgaggtgctgaacgcccacggcatcctgtggatctccgacgag
gtgcagaccggctgggggcgcaccggcgagcacttctggggctggcaggcgcacgcccgc
agcggcccgccggacatcgtcaccttcgccaagggcatcggcaacggctcgtccatcggc
ggcgtgatcgcccgcgccgagatcatgaactgcctggacgccaacagcatctcgaccttc
ggcggcacccagctcaccatggccgcgggcctcgccaacctcacctacctcctcgaacac
gacctccagggcaacgcccggcgcgtcggcggactgctcatcgagcggctgcgggccgtc
gccgcccagctccccggggtccgcgaggtgcgcgggcggggactgatgatcggcgtcgaa
ctcgtcaggcccggcaccgacgaggccgacccgcgggcggccgcggccgtcctggaggcg
gcccgcgagggcgggctgctcatcggcaagggcggcggccacgacaccagcgccctgcgc
atcgccccgccgctgtcgctgaccgtcgcggaggccgaggagggcgccgcgatcctcgaa
tccgccctgaggagcacgtactag

DBGET integrated database retrieval system