KEGG   Streptomyces collinus: B446_30150Help
Entry
B446_30150        CDS       T02787                                 

Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sci  Streptomyces collinus
Pathway
sci00511  Other glycan degradation
sci00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    B446_30150
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B446_30150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sci02042]
    B446_30150
Enzymes [BR:sci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     B446_30150
Bacterial toxins [BR:sci02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   B446_30150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR_3 Laminin_G_2 BNR Laminin_G_1 DUF4185
Motif
Other DBs
NCBI-ProteinID: AGS72834
UniProt: S5VCF3
LinkDB All DBs
Position
complement(6970809..6972659)
Genome map
AA seq 616 aa AA seqDB search
MPATVLTTAALVALPLVSPHPAHAHAGAGSPAAEFEQQVLFKASQDPGYACFRIPAVVRS
TDGTLLAFAEGRVLNCGDAADIDIVVKRSTDGGRTWGPLRVVNEGAGDTHGNPAPVVDRE
TGRIWLAETYNTGRTDSASCSVPCDRTPHLQYSDDDGQTWSAPRDLSPEILPADWNSWYA
TGPVHGIQLTRGRYAGRLVFGVNTETWDGSRVTANHAALVVSDDHGGHWRIGATDTWPVA
ADGTFRQKPSELTLAERADGSVLVSGREQDGTDLGHRTQAVSWDGGGSFTAPFRGLPDLY
APQVQGSMLRLGDRILLSCPADPDRRRTMMVRSSYDGGRTWDSVDRGTVVTTDWSGYSDL
VRADRDTVGLLYEGGAVDARDEIRFARFTEDWLAPRRGPDPRTADLAPRARPAAVLGGAR
ETDGVSGGALEFDGADDAVRLPYRPGLLLGGGDFTASLWFRYTAGTGEQPLLWMGGVGTS
QPQVWVRGEPANHRLQGLITVRDGAAAPQTAYVRTADAYNDGAWHHLVLRRSADALSLTV
DGMRSTVAGVPGSVSRNSPFGVHIGQRVDSRAFFTGAIDEVHVWDRALTDEELSDPKAPP
FLKDTVLWLPLDRVSG
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
gtgccggccaccgtcctcaccacggcggcgctggtggcgctcccgctcgtctccccccac
ccggcgcacgcccacgcgggcgccggctcgcccgcagccgagttcgagcagcaggtcctc
ttcaaggcgtcccaggaccccggatacgcctgtttccgcatcccggcggtcgtgcggagc
acggacggcacgctgctggcgttcgccgaggggcgggtgctgaactgcggtgacgcggcg
gacatcgacatcgtggtcaagcgttccacggacggcggccgcacctggggcccgctgcgg
gtggtcaacgagggcgcgggcgacacgcacggcaacccggcgcccgtcgtggaccgggag
accggccggatctggctggcggagacgtacaacaccggccgtacggacagcgcgagttgc
tcggtcccctgcgaccgcaccccgcatctgcagtacagcgacgacgacgggcagacctgg
tcggcgccgcgcgacctgagccccgagatcctgcccgccgactggaactcctggtacgcg
accggtccggtgcacggcatccagctcacccgcggccggtacgcgggccggctggtcttc
ggcgtcaacaccgagacctgggacggcagccgggtcaccgccaaccacgccgcgctcgtc
gtcagcgacgaccacggcggccactggcggatcggcgccaccgacacctggcccgtcgcc
gccgacggcaccttccggcagaagccctccgagctgaccctcgccgagcgcgccgacggc
tcggtcctggtcagcggccgcgagcaggacggcaccgacctcggccaccgcacccaggcc
gtcagctgggacggcggtggcagcttcaccgcccccttccgcgggctgccggacctctac
gccccgcaggtccagggttcgatgctgcgcctgggcgaccgcatcctgctctcctgcccc
gccgaccccgaccggcgccgcacgatgatggtccgctcctcctacgacggcggccgcacc
tgggacagcgtggaccgcggcacggtcgtcaccaccgactggtccggctactccgacctg
gtgcgcgccgaccgcgacaccgtgggcctgctgtacgagggcggcgcggtcgacgcgcgt
gacgagatccgcttcgcccgcttcaccgaggactggctcgccccgcgccgcggcccggac
ccgcgcaccgccgacctcgccccgcgcgcccggccggccgcggtgctgggcggtgcccgg
gagacggacggcgtgtccgggggcgcgctggagttcgacggcgccgacgacgccgtacgc
ctgccgtaccggcccgggctgttgctgggcggcggcgacttcaccgcgtccctgtggttc
cggtacacggccggcaccggggagcagcccctgctgtggatgggcggtgtcggcaccagc
cagccgcaggtctgggtgcgcggcgaacccgcgaaccaccgcctccaggggctcatcacg
gtgcgcgacggcgccgcggcgccgcagaccgcgtacgtgcggaccgccgacgcctacaac
gacggcgcctggcaccacctggtgctgcgccggtcggccgacgcgttgtcgttgacggtc
gacggtatgcggtcgaccgtcgccggtgtaccgggttccgtcagccgtaactcgcccttc
ggggtgcacatcggccagcgtgtcgacagccgggccttcttcaccggtgcgatcgacgag
gtgcatgtgtgggaccgggcgctgaccgacgaggagctgtccgacccgaaggcgccgccg
ttcctcaaggacaccgtgctgtggctgccgctggaccgggtctccggctga

DBGET integrated database retrieval system