KEGG   Streptomyces collinus: B446_30620Help
Entry
B446_30620        CDS       T02787                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
sci  Streptomyces collinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AGS72928
UniProt: S5V028
LinkDB All DBs
Position
complement(7079089..7080153)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPVKPMLAKSVARIPPGMHYEAKWDGFRALVFRDGDEVELGSRTGKPLTRYFPE
LVAALKERVPTRCVLDGEIVIAREGRLDFDALTERIHPAASRVRTLAERTPASFVAFDVL
ALGDRSLVQAPLTERRALLERELSGAGAPVHVAPATTDAELARRWFEQYEGAGLDGVVAK
PLTLRYLQDERAMFKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDDRGALQHVGVSAA
FPMKRRAELIEELEPLRMEDVGGHPWAAWGEEAAHETARLPGAPSRWSGKKDLSWVPLRP
ERVAEVAYDHMENGARFRHTARFRRWRPDRTAESCTYTQLEEPVRYDLGEILGT
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccggtgatgccgcctgtgaagcccatgctcgccaagtcggtggcgcgcatc
ccgcccggcatgcactacgaggccaagtgggacgggttccgggccctcgtgttccgcgac
ggcgacgaggtggagctgggcagccgtaccggcaagccgctgaccaggtacttccccgag
ctggtcgcggcgctgaaggagcgggtgccgacgcggtgcgtgctggacggggagatcgtg
atcgcccgcgaggggcggctggacttcgacgcgctgaccgagcggatccatccggcggcc
tcccgggtgcggacgctggccgagcggacgccggcgtcgttcgtcgccttcgacgtgctg
gcgctcggcgaccgctcgctggtgcaggccccgctcaccgagcggcgggccctgctggag
cgggagttgtcgggggcgggcgcgccggtgcacgtggcaccggcgacgacggacgcggag
ctggcgcggcggtggttcgagcagtacgagggtgccgggctcgacggggtcgtcgccaag
ccgctgacgttgcgctatctgcaggacgagcgggccatgttcaagatcaagcacgagcgg
acggcggacgtcgtggtggcgggctaccggttccacaagagcggtccggtggtcggttcg
ctgctgctcggcctgtacgacgaccggggcgcgctgcagcacgtgggggtgtcggcggcc
ttccccatgaagcggcgcgccgagctgatcgaggagctggagccgctgcggatggaggac
gtgggcgggcatccgtgggcggcctggggggaggaggcggcccatgagacggcccggctg
ccgggggcaccgagccgctggtcgggcaagaaggacctgtcgtgggtgccgctgcggccg
gagcgggtcgccgaggtggcctacgaccacatggagaacggcgcccgcttccggcacacg
gcgcgcttccgccgctggcgcccggaccggacggccgagagctgcacgtacacccagctg
gaggagccggtgcgctacgacctcggcgagatcctgggcacctag

DBGET integrated database retrieval system